PDBID: | 9clz | Status: | HPUB -- hold until publication | Title: | Novel designed icosahedral nanoparticle I3-A6 | Authors: | Haas, C.M., Jasti, N., Dosey, A.M., Gillespie, R., Allen, J.D., Leaf, E.M., Crispin, M., DeForest, C., Kanekiyo, M., King, N.P. | Deposition date: | 2024-07-12 |
|
PDBID: | 9cll | Status: | HPUB -- hold until publication | Title: | Plasmodium falciparum tyrosyl-tRNA synthetase in complex with ML471-Tyr | Authors: | Tai, C.W., Dogovski, C., Xie, S.C., Tilley, L., Griffin, M.D.W. | Deposition date: | 2024-07-11 |
|
PDBID: | 9clo | Status: | HPUB -- hold until publication | Title: | DosP R97A with c-di-GMP | Authors: | Kumar, P., Kober, D.L. | Deposition date: | 2024-07-11 |
|
PDBID: | 9ckj | Status: | AUTH -- processed, waiting for author review and approval | Title: | Co-crystal structure of 53BP1 tandem Tudor domains in complex with UNC9512 | Authors: | Zeng, H., Dong, A., Shell, D.J., Foley, C., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC) | Deposition date: | 2024-07-09 |
|
PDBID: | 9io3 | Status: | HPUB -- hold until publication | Title: | D-Amino Acid Substituted Antimicrobial Peptides Derived from Tilapia piscidin 4 | Authors: | Huang, Y.P., Chang, C.F. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g06 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Structure of 30S-IF1-IF3-mRNA-fMet-tRNA-GE81112A complex | Authors: | Safdari, H.A., Morici, M., Wilson, D.N. | Deposition date: | 2024-07-07 |
|
PDBID: | 9fzf | Status: | HPUB -- hold until publication | Title: | Transcriptional repressor NrdR from E. coli, ADP/dATP bound state | Authors: | Bimai, O., Rozman Grinberg, I., Sjoberg, B.M., Logan, D.T. | Deposition date: | 2024-07-05 | Sequence: | >Entity 1 MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAELVMPRVVKSNDVREPFNEEKLRSGMLRALEKRPVSSDDVEMAINHIKSQLRATGEREVPSKMIGNLVMEQLKKLDKVAYIRFASVYRSFEDIKDFGEEIARLEDKLAAALEHHHHHH
|
|
PDBID: | 9fzb | Status: | HPUB -- hold until publication | Title: | Human p53 DNA-binding domain bound to DARPin C10-H82R | Authors: | Yuksel, B., Balourdas, D.I., Muenick, P., Knapp, S., Doetsch, V., Joerger, A.C., Structural Genomics Consortium (SGC) | Deposition date: | 2024-07-05 |
|
PDBID: | 9fz6 | Status: | HPUB -- hold until publication | Title: | A 2.58A crystal structure of S. aureus DNA gyrase and DNA with metals identified through anomalous scattering | Authors: | Morgan, H., Duman, R., Bax, B.D., Warren, A.J. | Deposition date: | 2024-07-04 |
|
PDBID: | 9fyw | Status: | HPUB -- hold until publication | Title: | X-ray structure of the adduct formed upon reaction of RNase A with [Ru2Cl(D-p-CNPhF)(O2CCH3)3] | Authors: | Teran, A., Ferraro, G., Merlino, A. | Deposition date: | 2024-07-04 |
|
PDBID: | 9fyq | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of native SV2A in complex with TeNT-Hc, gangliosides and Pro-Macrobody 5 | Authors: | Schenck, S., Brunner, J.D. | Deposition date: | 2024-07-03 |
|
PDBID: | 9fyr | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of native SV2A in complex with TeNT-Hc, Pro-Macrobody 5 and Levetiracetam | Authors: | Schenck, S., Brunner, J.D. | Deposition date: | 2024-07-03 |
|
PDBID: | 9fyj | Status: | HPUB -- hold until publication | Title: | N-terminal domain of human galectin-8 in complex with an alpha-galactoside ligand | Authors: | Adrover Forteza, J., Puric, E., Nilsson, U.J., Anderluh, M., Logan, D.T. | Deposition date: | 2024-07-03 | Sequence: | >Entity 1 SLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSD
|
|
PDBID: | 9fx9 | Status: | HPUB -- hold until publication | Title: | CryoEM structure of RV-A89 | Authors: | Wald, J., Goessweiner-Mohr, N., Blaas, D., Marlovits, T.C. | Deposition date: | 2024-07-02 |
|
PDBID: | 9fxz | Status: | HPUB -- hold until publication | Title: | Galectin-8 N-terminal carbohydrate recognition domain in complex with 4-(bromophenyl)phthalazinone D-galactal ligand | Authors: | Van Klaveren, S., Hakansson, M., Diehl, C., Nilsson, N.J. | Deposition date: | 2024-07-02 |
|
PDBID: | 9fy0 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Saccharolobus solfataricus 30S initiation complex bound to Ss-aIF2beta leaderless mRNA | Authors: | Bourgeois, G., Coureux, P.D., Mechulam, Y., Schmitt, E. | Deposition date: | 2024-07-02 |
|
PDBID: | 9fy5 | Status: | HPUB -- hold until publication | Title: | CRYSTAL STRUCTURE OF HUMAN MONOACYLGLYCEROL LIPASE WITH COMPOUND | Authors: | Gazzi, T., Grether, U., Nazare, M., Hochstrasser, R., Wang, H., Heer, D., Topp, A., Benz, J. | Deposition date: | 2024-07-02 |
|
PDBID: | 9im4 | Status: | HPUB -- hold until publication | Title: | Crystal Structure of AF9 YEATS domain F28R mutant in complex with histone H3K9la | Authors: | Li, H.T., Ma, H.D. | Deposition date: | 2024-07-02 |
|
PDBID: | 9ci4 | Status: | HPUB -- hold until publication | Title: | Crystal structure of Fe/2-OG dependent dioxygenase MysH (Apo form) | Authors: | Wanniarachchi, T.N., Bruner, S.D. | Deposition date: | 2024-07-02 |
|
PDBID: | 9chu | Status: | AUCO -- author corrections pending review | Title: | Cryo-EM structure of calcineurin fused beta2 adrenergic receptor in norepinephrine bound inactive state | Authors: | Jun, X., Geng, C., Yang, D., Brian, K.K. | Deposition date: | 2024-07-02 |
|
PDBID: | 9chv | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | cryo-EM structure of calcineurin-fused beta2 adrenergic receptor in apo state | Authors: | Jun, X., Geng, C., Yang, D., Brian, K.K. | Deposition date: | 2024-07-02 |
|
PDBID: | 9chx | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | cryo-EM structure of calcineurin-fused beta2 adrenergic receptor in carazolol bound inactive state | Authors: | Jun, X., Geng, C., Yang, D., Brian, K.K. | Deposition date: | 2024-07-02 |
|
PDBID: | 9fxk | Status: | HPUB -- hold until publication | Title: | Transcription repressor NrdR from E. coli, AMPPNP/ATP-bound state | Authors: | Bimai, O., Logan, D.T. | Deposition date: | 2024-07-01 |
|
PDBID: | 9fx1 | Status: | HPUB -- hold until publication | Title: | CryoEM structure of RV-A89 | Authors: | Wald, J., Goessweiner-Mohr, N., Blaas, D., Marlovits, T.C. | Deposition date: | 2024-07-01 |
|
PDBID: | 9fww | Status: | HPUB -- hold until publication | Title: | Human NKp30 in complex with a VHH variant | Authors: | Musil, D., Freire, F. | Deposition date: | 2024-07-01 |
|