| PDBID: | 9ddl | | Status: | HOLD -- hold until a certain date | | Title: | Glutathione transferase sigma class from Taenia solium | | Authors: | Miranda-Blancas, R., Cardona-Echavarria, M.C., Sanchez, C., Sanchez-Perez, L.C., Flores-Lopez, R., Rodriguez-Lima, O., Garcia-Gutierrez, P., Zubillaga, R., Landa, A., Rudino-Pinera, E. | | Deposition date: | 2024-08-28 | | Release date: | 2025-08-28 | | Sequence: | >Entity 1
MDLQLKQAKLRLLYFNIRGRAELIRLVLNAAEKDFEDVRVSETEWPSLKSKMPFNQLPVLEVTTPNGQKVMLTESMAIARLLARTFGLYGDNAAEVYLIERMNSLTSSLLEEIYALGLKKVDSFKKLFEAEHLHEYMNAIEMALKERKSTFIAGPRVTLADLQVIVLIDTMNKFLPNTKHECKDKLDEIKEGVIRTKPGVARYLRSRPATDF
|
|
| PDBID: | 9ddr | | Status: | HPUB -- hold until publication | | Title: | Ternary substrate complex of DNA polymerase iota with DNA (template A), Ca2+, and dTTP | | Authors: | Frevert, Z., Reusch, D., Freudenthal, B., Washington, M.T. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9dde | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9deb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9ded | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9de0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The Cryo-EM structure of a complex between GAD65 and b96.11 Fab | | Authors: | Reboul, C.F., Le, S.N., Williams, D.E., Buckle, A.M. | | Deposition date: | 2024-08-28 | | Release date: | 2025-08-28 |
|
| PDBID: | 9ddx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9de1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Q108K:K40L:T51V:T53C:R58Y:Y19W:Q38L:Q4A:T29L mutant of hCRBPII bound to FR1V in the dark at pH 6.0 | | Authors: | Bingham, C., Geiger, J.H. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9dee | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9def | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9ddz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9deg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9de6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9de7 | | Status: | HPUB -- hold until publication | | Title: | Structure of full-length HIV TAR RNA G16A/A17G | | Authors: | Bou-Nader, C., Zhang, J. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9de5 | | Status: | HPUB -- hold until publication | | Title: | Structure of full-length HIV TAR RNA bound to HIV Tat RNA-binding domain | | Authors: | Bou-Nader, C., Zhang, J. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9deh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9de8 | | Status: | HPUB -- hold until publication | | Title: | Structure of full-length HIV TAR RNA soaked in CaCl2 | | Authors: | Bou-Nader, C., Zhang, J. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9de3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NDM-1 complexed with compound 28 | | Authors: | Jacobs, L.M.C., Chen, Y. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9dea | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9de9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9de4 | | Status: | HPUB -- hold until publication | | Title: | Er-Bound Structure of Computationally Designed Homotetramer PW1 | | Authors: | Hoffnagle, A.M., Tezcan, F.A. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9dec | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9gl4 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the freshwater actinorhodopsin, Rhodoluna lacicola (RlActR) | | Authors: | Djabeur, N., Jeckelmann, J.-M., Fotiadis, D. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glb | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Deacetylase (HdaH) from Klebsiella pneumoniae subsp. ozaenae | | Authors: | Qin, C., Graf, L.G., Schulze, S., Palm, G.J., Lammers, M. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9gla | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-27 |
|
