| PDBID: | 9qz9 | | Status: | HPUB -- hold until publication | | Title: | mycobacterial cytochrome bc1:aa3 with inhibitor | | Authors: | Lamers, M.H., Verma, A.K., Noteborn, W.E.M. | | Deposition date: | 2025-04-22 |
|
| PDBID: | 9o9w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of an alpha/beta-hydrolase from Actinoplanes sp. DH11 | | Authors: | Norton-Baker, B., Storment, O., Mathews, I.I., Gauthier, N.P., McGeehan, J.E., Beckham, G.T. | | Deposition date: | 2025-04-18 |
|
| PDBID: | 9o9i | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of mouse Vps29 bound to DENND4C peptide (re-refinement) | | Authors: | Chen, K.-E., Collins, B. | | Deposition date: | 2025-04-18 |
|
| PDBID: | 9qy5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of non-specific endoxylanase from Acetivibrio clariflavus (AcXyn30B), that belongs to subfamily GH30_12. | | Authors: | Karampa, P., Dimarogona, M., Pentari, C., Topakas, E. | | Deposition date: | 2025-04-17 |
|
| PDBID: | 9qy9 | | Status: | HPUB -- hold until publication | | Title: | Listeria monocytogenes GT108 family enzyme, native | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-17 |
|
| PDBID: | 9o8w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of an MKP5 mutant, Y435F, in complex with an allosteric inhibitor | | Authors: | Manjula, R., Bennett, A.M., Lolis, E. | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9qy4 | | Status: | HPUB -- hold until publication | | Title: | GT108 family enzyme from Chlamydia abortus in complex with mannose-1-phosphate (M1P) | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9qwv | | Status: | HPUB -- hold until publication | | Title: | Trypanosoma cruzi enoyl-CoA hydratase | | Authors: | Brannigan, J.A., Dodson, E.J. | | Deposition date: | 2025-04-15 | | Sequence: | >Entity 1
MLRKSLFLLNSMDPIVKYAQKGAVVTLTLNRPKQLNALNAELTNALAEKLLKCDADPSVSVLIITGEGRSFVAGADIKAMANQTFVEFYKHNMLRGLDTIAAVRKPIIAAVNGFALGGGCELAMSCDIVVASEKAIFGQPEIKIGTIPGAGGTQRLTRLIGKSKAMEWILTGEQYTAEEAERAGLVSRVVRHEELLPTVSAMAEKIALNSPLAVSLAKDCINKALETTLAQGMAYEQRTFQATFATDDQKEGMAAFVEKRKPNFKNA
|
|
| PDBID: | 9qx3 | | Status: | HPUB -- hold until publication | | Title: | E. coli beta-clamp in complex with designed circular peptide | | Authors: | Simonsen, S., Zhao, J., Soegaard, K., Olsen, J.G., Otterlei, M., Rogers, J.M., Kragelund, B.B. | | Deposition date: | 2025-04-15 | | Sequence: | >Entity 1
HHMKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALVQPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGERMLVRSGRSRFSLSTLPAADFPNLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELRTVATDGHRLAVCSMPIGQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNEKFRGVRLYVSENQLKITANNPEQEEAEEILDVTYSGAEMEIGFNVSYVLDVLNALKCENVRMMLTDSVSSVQIEDAASQSAAYVVMPMRL
>Entity 2
(DPN)VFVNLWYEGFS(CCS)(NH2)
|
|
| PDBID: | 9qwt | | Status: | HPUB -- hold until publication | | Title: | Mouse Ribosome RPS15 (uS19) P131S rotated-2 PRE state | | Authors: | Santo, P.E., Astier, A., Plisson-Chastang, C. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qxm | | Status: | HPUB -- hold until publication | | Title: | Nostoc sp. 3335mg GT108 family enzyme complex with DMJ | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qx4 | | Status: | HPUB -- hold until publication | | Title: | Nostoc sp. 3335mg GT108 family enzyme purified in HEPES, with Bis-Tris propane and phosphate in the active site | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9o6n | | Status: | HPUB -- hold until publication | | Title: | Structure of Siglec-10 | | Authors: | Medina, E., Ming, Q., Tran, T.H., Luca, V.C. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o6o | | Status: | HPUB -- hold until publication | | Title: | Structure of SigLec-10 in complex with 2,6-Sialyllactose | | Authors: | Medina, E., Ming, Q., Tran, T.H., Luca, V.C. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o75 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IgG1 I253M at pH 6.5 | | Authors: | Reddem, E.R., Shapiro, L. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o70 | | Status: | HPUB -- hold until publication | | Title: | Motif1-Motif2, two domain left-handed parallel G-quadruplex | | Authors: | Xing, E.R., Yatsunyk, L.A. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o78 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IgG1 I253M at pH 7.0 | | Authors: | Reddem, E.R., Shapiro, L. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o7a | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IgG1 WT FC at pH 7.0 | | Authors: | Reddem, E.R., Shapiro, L. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qw5 | | Status: | HPUB -- hold until publication | | Title: | Urate Oxidase from Aspergillus Flavus with its Inhibitor 9-Methyl Uric Acid by continuous serial electron diffraction (SerialED) | | Authors: | Hofer, G., Wang, L., Pacoste, L., Hager, P., Fonjallaz, A., Scaletti Hutchinson, E., Stenmark, P., Di Palma, M., Williams, L., Worral, J., Steiner, R., Xu, H., Zou, X. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qw6 | | Status: | HPUB -- hold until publication | | Title: | Urate Oxidase from Aspergillus Flavus with its Substrate Uric Acid by continuous serial electron diffraction (SerialED) | | Authors: | Hofer, G., Wang, L., Pacoste, L., Hager, P., Fonjallaz, A., Scaletti Hutchinson, E., Stenmark, P., Di Palma, M., Williams, L., Worral, J., Steiner, R., Xu, H., Zou, X. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o6j | | Status: | HPUB -- hold until publication | | Title: | Structure of Siglec-10 in complex with 2,3-Sialyllactose | | Authors: | Medina, E., Ming, Q., Tran, T.H., Luca, V.C. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9qvy | | Status: | HPUB -- hold until publication | | Title: | Nostoc sp. 3335mg GT108 family enzyme complex with mannose-1-phosphate (M1P) | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9qw0 | | Status: | HPUB -- hold until publication | | Title: | Nostoc sp. 3335mg GT108 family enzyme D90A mutant complex with octyl-mannotetraose and Bis-Tris | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9qw1 | | Status: | HPUB -- hold until publication | | Title: | Nostoc sp. 3335mg GT108 family enzyme D90A mutant complex with octyl-mannotetraose | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9qvw | | Status: | HPUB -- hold until publication | | Title: | Nostoc sp. 3335mg GT108 family enzyme native | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-12 |
|
