| PDBID: | 8z09 | | Status: | HPUB -- hold until publication | | Title: | DUF2436 domain which is frequently found in virulence proteins from Porphyromonas gingivalis | | Authors: | Kim, B., Hwang, J., Do, H., Lee, J.H. | | Deposition date: | 2024-04-09 |
|
| PDBID: | 9bch | | Status: | HPUB -- hold until publication | | Title: | Solution structure of the hemoglobin receptor HbpA from Corynebacterium diphtheriae | | Authors: | Mahoney, B.J., Clubb, R.T. | | Deposition date: | 2024-04-09 | | Sequence: | >Entity 1
SEEVKNADLYWGFSGSSHHKYDHNGPKFEKAGKGAELTNIDAASAYAETFKKGVFPNNKREKSDILVFHNGEVKTETNHSSYQINWPGEVTMKLGYGDGLVIKDLNLMLKNGNMGELKATVGENSNITLFDVQEYSVSDNTITVTPKIPPCTTGTWKPWHNDLTSKLGSLKSVFFESYTCNNDDIAKKPLPLTVVLNG
|
|
| PDBID: | 9bcg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Myeloid cell leukemia-1 (Mcl-1) complexed with compound | | Authors: | Zhao, B., Fesik, S.W. | | Deposition date: | 2024-04-09 |
|
| PDBID: | 8yzw | | Status: | HPUB -- hold until publication | | Title: | The structure of HLA/peptide from virus | | Authors: | Liu, J., Tian, J.M., Shang, B.L. | | Deposition date: | 2024-04-08 |
|
| PDBID: | 8yza | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PtmB in complex with cyclo-(L-Trp-L-Trp) and Guanine | | Authors: | Zhang, Z.Y., Qu, X.D., Duan, B.R., Wei, G.Z. | | Deposition date: | 2024-04-06 |
|
| PDBID: | 8yz8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PtmB in complex with Adenine | | Authors: | Zhang, Z.Y., Qu, X.D., Duan, B.R., Wei, G.Z. | | Deposition date: | 2024-04-06 |
|
| PDBID: | 9bb9 | | Status: | HPUB -- hold until publication | | Title: | Structure of S1_8A, a lambda-carrageenan specific sulfatase | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-05 |
|
| PDBID: | 9bba | | Status: | HPUB -- hold until publication | | Title: | Structure of S1_8C, a lambda-carrageenan specific sulfatase | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-05 |
|
| PDBID: | 9bbd | | Status: | HPUB -- hold until publication | | Title: | Structure of S1_8B, a lambda-carrageenan specific sulfatase | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-05 |
|
| PDBID: | 8yyp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PtmB in complex with cyclo-(L-Trp-L-Trp) and Adenine | | Authors: | Zhang, Z.Y., Qu, X.D., Duan, B.R., Wei, G.Z. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 9bay | | Status: | HPUB -- hold until publication | | Title: | Single full-chain subunit of the Vpb4Aa2 Pore Complex. | | Authors: | Wirawan, R., Spicer, B.A., Bayly-Jones, C.J., Lupton, C., Venugopal, H., Berry, C., Dunstone, M. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 9ban | | Status: | HPUB -- hold until publication | | Title: | The Anti-Mullerian Hormone prodomain in complex with the growth factor and 6E11 Fab in C1 symmetry | | Authors: | Howard, J.A., Thompson, T.B. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 9bar | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the alpha parvalbumin from thornback ray | | Authors: | O''Malley, A., Kapingidza, A.B., Ruethers, T., Lopata, A.L., Chruszcz, M. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 9bao | | Status: | HPUB -- hold until publication | | Title: | The Anti-Mullerian Hormone prodomain in complex with the growth factor and 6E11 Fab in C2 symmetry | | Authors: | Howard, J.A., Thompson, T.B. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 9bas | | Status: | HPUB -- hold until publication | | Title: | Structure of S1_15A, a lambda-carrageenan specific sulfatase, in complex with galactose-6-sulfate | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 9bau | | Status: | HPUB -- hold until publication | | Title: | Structure of S1_15B, a lambda-carrageenan specific sulfatase, in complex with galactose-6-sulfate | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 9bav | | Status: | HPUB -- hold until publication | | Title: | Structure of S1_15B, a lambda-carrageenan specific sulfatase, in complex with a carrageenoligosaccharide | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 8yxu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of CsoS1A/B (modeled with CsoS1A) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yy7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PtmB in complex with cyclo-(L-Trp-L-Trp) and Hypoxanthine | | Authors: | Zhang, Z.Y., Qu, X.D., Duan, B.R., Wei, G.Z. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9evw | | Status: | HPUB -- hold until publication | | Title: | Avian reovirus nonstructural protein sigmaNS | | Authors: | Kascakova, B., Tuma, R. | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8yxt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PtmB | | Authors: | Zhang, Z.Y., Qu, X.D., Duan, B.R., Wei, G.Z. | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8yww | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The structure of HKU1-B S protein with bsAb1 | | Authors: | Xia, L.Y., Zhang, Y.Y., Zhou, Q. | | Deposition date: | 2024-04-01 |
|
| PDBID: | 8ywu | | Status: | HPUB -- hold until publication | | Title: | Human PPAR alpha ligand binding domain in complex with a 1H-pyrazolo[3,4-b]pyridine-derived compound | | Authors: | Tachibana, K., Morie, T., Fukuda, S., Yuzuriha, T., Ishimoto, K., Nunomura, K., Lin, B., Miyachi, H., Oki, H., Kawahara, K., Meguro, K., Nakagawa, S., Tsujikawa, K., Akai, S., Doi, T., Yoshida, T. | | Deposition date: | 2024-04-01 |
|
| PDBID: | 8ywv | | Status: | HPUB -- hold until publication | | Title: | Human PPAR alpha ligand binding domain in complex with a 1H-pyrazolo[3,4-b]pyridine-derived compound | | Authors: | Tachibana, K., Morie, T., Fukuda, S., Yuzuriha, T., Ishimoto, K., Nunomura, K., Lin, B., Miyachi, H., Oki, H., Kawahara, K., Meguro, K., Nakagawa, S., Tsujikawa, K., Akai, S., Doi, T., Yoshida, T. | | Deposition date: | 2024-04-01 |
|
| PDBID: | 9b95 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the closed NF449-bound human P2X1 receptor | | Authors: | Felix, M.B., Alisa, G., Hariprasad, V., Jesse, I.M., David, M.T. | | Deposition date: | 2024-04-01 |
|
