| PDBID: | 8xrd | | Status: | HPUB -- hold until publication | | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | | Authors: | Sun, J., Zheng, T.Y. | | Deposition date: | 2024-01-06 |
|
| PDBID: | 8kdi | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-09 |
|
| PDBID: | 9fe0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-17 |
|
| PDBID: | 8xrb | | Status: | HPUB -- hold until publication | | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | | Authors: | Sun, J., Zheng, T.Y. | | Deposition date: | 2024-01-06 |
|
| PDBID: | 8kdn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-09 |
|
| PDBID: | 9fdo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-17 |
|
| PDBID: | 8xra | | Status: | HPUB -- hold until publication | | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | | Authors: | Sun, J., Zheng, T.Y. | | Deposition date: | 2024-01-06 |
|
| PDBID: | 8kdo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-09 |
|
| PDBID: | 9fe9 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-17 |
|
| PDBID: | 8xr9 | | Status: | HPUB -- hold until publication | | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | | Authors: | Sun, J., Zheng, T.Y. | | Deposition date: | 2024-01-06 |
|
| PDBID: | 8kdp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-09 |
|
| PDBID: | 9fe5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-17 |
|
| PDBID: | 8xrp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-07 | | Sequence: | >Entity 1
LSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASHHHHHH
>Entity 2
AIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
>Entity 3
KIDACKRGDVTVKPSHVILLGSTVNITCSLKPRQGCFHYSRRNKLILYKFDRRINFHHGHSLNSQVTGLPLGTTLFVCKLACINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACTWERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFGINLTPESPESNFTAKVTAVNSLGSSSSLPSTFTFLDIVRPLPPWDIRIKFQKASVSRCTLYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKAKGRHDLLDLKPFTEYEFQISSKLHLYKGSWSDWSESLRAQTPEEHHHHHH
>Entity 4
CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPHHHHHH
|
|
| PDBID: | 8kdq | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -T03 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-09 |
|
| PDBID: | 9fe7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-17 |
|
| PDBID: | 8xrl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-07 |
|
| PDBID: | 8q5y | | Status: | HPUB -- hold until publication | | Title: | cryoEM structure of SARS-CoV2 Spike trimer in complex with Fab23 | | Authors: | Hallberg, M., Das, H. | | Deposition date: | 2023-08-10 |
|
| PDBID: | 9fe8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-17 |
|
| PDBID: | 8xrn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-07 |
|
| PDBID: | 8q65 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-10 |
|
| PDBID: | 9fea | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-17 |
|
| PDBID: | 8q64 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of hydroxylated HIF2alpha-CODD peptide (523-542) bound to apo-HIF prolyl hydroxylase 2 (PHD2 181-407) | | Authors: | Fiorini, G., Figg Jr, W.D., Schofield, C.J. | | Deposition date: | 2023-08-10 |
|
| PDBID: | 9fed | | Status: | HPUB -- hold until publication | | Title: | Single-chain chimeric protein mimicking the interaction between HR1 and HR2 in HIV gp41 | | Authors: | Camara-Artigas, A., Gavira, J.A., Conejero-Lara, F., Polo-Megias, D. | | Deposition date: | 2024-05-18 |
|
| PDBID: | 8xrg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-07 |
|
| PDBID: | 8kdu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of trypsin with its substrate | | Authors: | Akbar, Z., Ahmad, M.S. | | Deposition date: | 2023-08-10 |
|
