| PDBID: | 8pxb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-23 |
|
| PDBID: | 8xhp | | Status: | HPUB -- hold until publication | | Title: | The apo structure of SsBcmC | | Authors: | Wu, L., Tang, G.L., Zhou, J.H. | | Deposition date: | 2023-12-18 |
|
| PDBID: | 9f7g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8py2 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the human BRISC dimer complex bound to compound JMS-175-2 | | Authors: | Chandler, F., Zeqiraj, E. | | Deposition date: | 2023-07-24 | | Release date: | 2025-01-24 |
|
| PDBID: | 9f7k | | Status: | HPUB -- hold until publication | | Title: | Glutathione transferase epsilon 1 from Drosophila melanogaster in complex with glutathione | | Authors: | Didierjean, C., Schwartz, M., Neiers, F. | | Deposition date: | 2024-05-03 | | Sequence: | >Entity 1
MSSSGIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLDAVHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAWLDRLNKLPYYKEINEAPAQSYVAFLRSKWTKLGDK
|
|
| PDBID: | 8xhl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-18 |
|
| PDBID: | 4khc | | Status: | POLC -- waiting for a policy decision | | Title: | Solution Structure of Heparan Sulphate dp6 | | Authors: | Khan, S., Fung, K.W., Mulloy, B., Perkins, S.J. | | Deposition date: | 2013-04-30 | | Release date: | 2019-04-12 |
|
| PDBID: | 8pxz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-24 |
|
| PDBID: | 9f7j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8xhm | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-18 | | Release date: | 2024-12-18 |
|
| PDBID: | 4khd | | Status: | POLC -- waiting for a policy decision | | Title: | Solution Structure of Heparan Sulphate dp8 | | Authors: | Khan, S., Fung, K.W., Mulloy, B., Perkins, S.J. | | Deposition date: | 2013-04-30 |
|
| PDBID: | 8py0 | | Status: | HPUB -- hold until publication | | Title: | Sensor domain of Oscillibacter ruminantium chemoreceptor in complex with formate. | | Authors: | Gavira, J.A., Krell, T., Monteagudo-Cascales, E., Velando, F., Matilla, M.A., Martinez-Rodriguez, S. | | Deposition date: | 2023-07-24 | | Release date: | 2025-01-24 |
|
| PDBID: | 9f7p | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 papain-like protease (PLpro) C112S mutant | | Authors: | Camara-Artigas, A. | | Deposition date: | 2024-05-04 |
|
| PDBID: | 8xht | | Status: | HPUB -- hold until publication | | Title: | The apo structure of PaBcmG | | Authors: | Wu, L., Tang, G.L., Zhou, J.H. | | Deposition date: | 2023-12-18 |
|
| PDBID: | 4khe | | Status: | POLC -- waiting for a policy decision | | Title: | Solution Structure of Heparan Sulphate dp10 | | Authors: | Khan, S., Fung, K.W., Mulloy, B., Perkins, S.J. | | Deposition date: | 2013-04-30 |
|
| PDBID: | 8pxp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Compound II structure of Y389F variant of A type dye-decolourising peroxidase DtpAa | | Authors: | Lucic, M., Thompson, A., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2023-07-24 |
|
| PDBID: | 9f7q | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 papain-like protease (PLpro) C112S mutant | | Authors: | Camara-Artigas, A. | | Deposition date: | 2024-05-04 |
|
| PDBID: | 8xhx | | Status: | HPUB -- hold until publication | | Title: | The complex structure of PaBcmG and its natural substrate | | Authors: | Wu, L., Tang, G.L., Zhou, J.H. | | Deposition date: | 2023-12-18 |
|
| PDBID: | 4khf | | Status: | POLC -- waiting for a policy decision | | Title: | Solution Structure of Heparan Sulphate dp12 | | Authors: | Khan, S., Fung, K.W., Mulloy, B., Perkins, S.J. | | Deposition date: | 2013-04-30 |
|
| PDBID: | 8pxq | | Status: | HPUB -- hold until publication | | Title: | SFX Ferric structure of Y389F variant of A type dye-decolourising peroxidase DtpAa | | Authors: | Lucic, M., Worrall, J.A.R., Hough, M.A., Pfalzgraf, H. | | Deposition date: | 2023-07-24 | | Release date: | 2025-01-24 |
|
| PDBID: | 9f7r | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 papain-like protease (PLpro) C112S mutant | | Authors: | Camara-Artigas, A. | | Deposition date: | 2024-05-04 |
|
| PDBID: | 8xhy | | Status: | HPUB -- hold until publication | | Title: | The complex structure of mutant T307A of SsBcmE and its natural substrate cIL | | Authors: | Wu, L., Tang, G.L., Zhou, J.H. | | Deposition date: | 2023-12-18 |
|
| PDBID: | 4khg | | Status: | POLC -- waiting for a policy decision | | Title: | Solution Structure of Heparan Sulphate dp14 | | Authors: | Khan, S., Fung, K.W., Mulloy, B., Perkins, S.J. | | Deposition date: | 2013-04-30 |
|
| PDBID: | 9f7s | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 papain-like protease (PLpro) C112S-K191D-K229R mutant | | Authors: | Camara-Artigas, A. | | Deposition date: | 2024-05-04 |
|
| PDBID: | 8xhz | | Status: | HPUB -- hold until publication | | Title: | protein-DNA complex | | Authors: | Li, Z. | | Deposition date: | 2023-12-18 |
|
