PDBID: | 9f4a | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-26 |
|
PDBID: | 8y2g | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-25 |
|
PDBID: | 8kdp | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 |
|
PDBID: | 9f42 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-26 |
|
PDBID: | 8y2l | Status: | HOLD -- hold until a certain date | Title: | The Crystal Structure of Glucosyltransferase TcdB from Clostridioides difficile | Authors: | Fan, S., Wei, X., Lv, R., Wang, C., Tang, M., Jin, Y., Yang, Z. | Deposition date: | 2024-01-26 | Release date: | 2025-01-26 |
|
PDBID: | 8kdq | Status: | HPUB -- hold until publication | Title: | De novo design protein -T03 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-08-09 |
|
PDBID: | 9f47 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-26 |
|
PDBID: | 8y2i | Status: | HPUB -- hold until publication | Title: | Ternary structure of dLesCas12e-sgRNA-dsDNA | Authors: | Zhang, S., Lin, S., Liu, J.J.G. | Deposition date: | 2024-01-26 |
|
PDBID: | 8pq3 | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-10 | Release date: | 2025-01-10 |
|
PDBID: | 9f49 | Status: | HOLD -- hold until a certain date | Title: | Structure of the bacteriophage K gp155 C-terminal domain, seleno-methionine modified version | Authors: | Pichel, A., van Raaij, M.J. | Deposition date: | 2024-04-26 | Release date: | 2024-06-21 | Sequence: | >Entity 1 KDF(MSE)LIGHRGATGYTDEHTIKGYQ(MSE)ALDKGADYIELDLQLTKDNKLLC(MSE)HDSTIDRTTTGTGKVGD(MSE)TLSYIQTNFTSLNGEPIPSLDDVLNHFGTKVKYYIETKRPFDAN(MSE)DRELLTQLKAKGLIGIGSERFQVIIQSFARESLINIHNQFSNIPLAYLTSTFSESE(MSE)DDCLSYGFYAIAPKYTTITKELVDLAHSKGLKVHAWTVNTKEE(MSE)QSLIQ(MSE)GVDGFFTNYLDEYKKI
|
|
PDBID: | 8y2j | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-26 |
|
PDBID: | 8pxo | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-07-23 | Release date: | 2025-01-23 |
|
PDBID: | 9eyg | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-09 |
|
PDBID: | 8y2o | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-01-26 |
|
PDBID: | 8q65 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-10 | Release date: | 2025-04-08 |
|
PDBID: | 9f4c | Status: | HPUB -- hold until publication | Title: | Structure of the C-terminal domain of CKAP5/chTOG | Authors: | Pfuhl, M. | Deposition date: | 2024-04-27 | Sequence: | >Entity 1 ASRIDEKSSKAKVNDFLAEIFKKIGSKENTKEGLAELYEYKKKYSDADIEPFLKNSSQFFQSYVERGLRVIEMEREGKGRISTSTGISPQMEVTCVPTPTSTVSSIGNTNGEEVGPSVYLERLKILRQRCGLDNTKQDDRP
|
|
PDBID: | 8y2k | Status: | HPUB -- hold until publication | Title: | The crystal structure of QX006N-Fab | Authors: | Li, W., Feng, W. | Deposition date: | 2024-01-26 |
|
PDBID: | 8q64 | Status: | HPUB -- hold until publication | Title: | Crystal structure of hydroxylated HIF2alpha-CODD peptide (523-542) bound to apo-HIF prolyl hydroxylase 2 (PHD2 181-407) | Authors: | Fiorini, G., Figg Jr, W.D., Schofield, C.J. | Deposition date: | 2023-08-10 |
|
PDBID: | 9f58 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-28 |
|
PDBID: | 8y2m | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-01-26 | Release date: | 2025-01-26 |
|
PDBID: | 8kdu | Status: | HPUB -- hold until publication | Title: | Crystal structure of trypsin with its substrate | Authors: | Akbar, Z., Ahmad, M.S. | Deposition date: | 2023-08-10 |
|
PDBID: | 9f4i | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-28 |
|
PDBID: | 9f5h | Status: | HPUB -- hold until publication | Title: | Crystal structure of MGAT5 bump-and-hole mutant in complex with UDP and M592 | Authors: | Liu, Y., Bineva-Todd, G., Meek, R., Mazo, L., Piniello, B., Moroz, O.V., Begum, N., Roustan, C., Tomita, S., Kjaer, S., Rovira, C., Davies, G.J., Schumann, B. | Deposition date: | 2024-04-28 |
|
PDBID: | 8y2t | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of 3C protease from coxsackievirus B3 | Authors: | Jiang, H.H., Zou, X.F., Zhang, J., Li, J. | Deposition date: | 2024-01-27 | Release date: | 2025-01-27 |
|
PDBID: | 9f56 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-28 |
|