PDBID: | 9f29 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-22 |
|
PDBID: | 8xyy | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-20 |
|
PDBID: | 9f2a | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-22 |
|
PDBID: | 8xz1 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-20 |
|
PDBID: | 9f27 | Status: | HPUB -- hold until publication | Title: | Solution structure of the Pyrococcus abyssi Rpa2 winged-helix domain | Authors: | Le Meur, R.A., Madru, C., Cordier, F., Sauguet, L., Guijarro, J.I. | Deposition date: | 2024-04-22 |
|
PDBID: | 8xz0 | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-01-20 | Release date: | 2025-01-20 |
|
PDBID: | 9f26 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the PriS_PriL-Rpa2WH ternary complex from P. abyssi | Authors: | Madru, C., Legrand, P., Haouz, A., Sauguet, L. | Deposition date: | 2024-04-22 |
|
PDBID: | 8xzc | Status: | HPUB -- hold until publication | Title: | Crystal structure of human cytosolic beta-alanyl lysine dipeptidase (PM20D2) Tyr314Phe mutant | Authors: | Chandravanshi, K., Kumar, A., Makde, R.D. | Deposition date: | 2024-01-21 |
|
PDBID: | 9f28 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the heterodimeric primase from pyrococcus abyssi (deletion of the PriL-CTD domain) | Authors: | Madru, C., Sauguet, L. | Deposition date: | 2024-04-22 |
|
PDBID: | 8xzu | Status: | HPUB -- hold until publication | Title: | HosA transcriptional regulator from enteropathogenic Escherichia coli O127:H6 (strain E2348/69) bound with 4-hydroxy benzoic acid - Conformation II at 2.33 angstrom resolution | Authors: | Manjunath, K., Goswami, A. | Deposition date: | 2024-01-21 | Sequence: | >Entity 1 MALRNKAFHQLRQLFQQHTARWQHELPDLTKPQYAVMRAIADKPGIEQVALIEAAVSTKATLAEMLARMENRGLVRREHDAADKRRRFVWLTAEGEKVLAAAIPIGDSVDEEFLGRLSAEEQELFMQLVRKMMNTLEHHHHHH
|
|
PDBID: | 9f22 | Status: | HPUB -- hold until publication | Title: | DARPin eGFP complex DP1 (3G190.24) | Authors: | Mittl, P.R., Winkelvoss, D. | Deposition date: | 2024-04-22 |
|
PDBID: | 8xzz | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 9f23 | Status: | HPUB -- hold until publication | Title: | DARPin eGFP complex DP2 (2G156) | Authors: | Mittl, P.R., Hansen, S. | Deposition date: | 2024-04-22 |
|
PDBID: | 8xzy | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 9f24 | Status: | HPUB -- hold until publication | Title: | DARPin eGFP complex DP4 (2G71) | Authors: | Mittl, P.R., Winkelvoss, D. | Deposition date: | 2024-04-22 |
|
PDBID: | 8y02 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of Short-wave-sensitive opsin 1 | Authors: | Peng, Q., Jiang, H.H., Cheng, X.Y., Li, J., Zhang, J. | Deposition date: | 2024-01-21 | Release date: | 2025-01-21 |
|
PDBID: | 8q0g | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-07-28 | Release date: | 2025-01-28 |
|
PDBID: | 9f2c | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-22 |
|
PDBID: | 8xza | Status: | HPUB -- hold until publication | Title: | BA.2.86 Spike in complex with bovine ACE2 (Local refinement) | Authors: | Yue, C., Liu, P. | Deposition date: | 2024-01-21 |
|
PDBID: | 9f25 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-22 |
|
PDBID: | 8xz9 | Status: | AUTH -- processed, waiting for author review and approval | Title: | BA.2.86 Spike in complex with bovine ACE2 (bound 2 ACE2) | Authors: | Yue, C., Liu, P. | Deposition date: | 2024-01-21 |
|
PDBID: | 9f2b | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-22 |
|
PDBID: | 8y00 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 9f2d | Status: | HPUB -- hold until publication | Title: | KIR2DL1 bound to RIFIN RBK21 | Authors: | Chamberlain, S.G., Higgins, M.K. | Deposition date: | 2024-04-22 |
|
PDBID: | 8xzs | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|