| PDBID: | 9iwa | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of apo AsfvPrimPol with dodecamer | | Authors: | Xu, K.E., Chen, Y.T. | | Deposition date: | 2024-07-25 | | Release date: | 2025-07-25 |
|
| PDBID: | 9cnu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | HIV-2 CA hexamer bound with Nup153 peptide; assembled with liposome templating | | Authors: | Cook, M., Freniere, C., Xiong, Y. | | Deposition date: | 2024-07-15 |
|
| PDBID: | 8wh2 | | Status: | HPUB -- hold until publication | | Title: | MPOX E5 hexamer 2ATP, 2ADP, and ssDNA binding comformation | | Authors: | Zhang, Z., Dong, C. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 9jaw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-25 | | Release date: | 2025-08-25 |
|
| PDBID: | 9cnv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | HIV-2 CA hexamer bound with CPSF6 peptide; assembled via liposome templating | | Authors: | Cook, M., Freniere, C., Xiong, Y. | | Deposition date: | 2024-07-15 |
|
| PDBID: | 8whn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 9jas | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-25 |
|
| PDBID: | 9cme | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-15 |
|
| PDBID: | 8whr | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-23 | | Release date: | 2025-03-26 |
|
| PDBID: | 9jau | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-25 |
|
| PDBID: | 9cmt | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of HP1alpha CSD-Agno complex | | Authors: | Goldgur, Y., Xie, W., Schaefer, U., Tarakhovsky, A., Patel, D., Chen, S. | | Deposition date: | 2024-07-15 |
|
| PDBID: | 8whd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 9jgg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Solution structure of Murinotoxin-1 | | Authors: | Lushpa, V.A., Kuzmenkov, A.I., Deyev, Y.A., Iunusova, V.A., Bocharov, E.V., Vassilevski, A.A. | | Deposition date: | 2024-09-07 |
|
| PDBID: | 9cmo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM model derived from localized reconstruction of Ad657-hexon-FII complex at 4.14A resolution | | Authors: | Reddy, V.S., Ma, O.X. | | Deposition date: | 2024-07-15 |
|
| PDBID: | 8whc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 9jgi | | Status: | PROC -- to be processed | | Deposition date: | 2024-09-07 |
|
| PDBID: | 9cmg | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-15 |
|
| PDBID: | 8whe | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-23 |
|
| PDBID: | 9jgh | | Status: | PROC -- to be processed | | Deposition date: | 2024-09-07 |
|
| PDBID: | 9cmw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-15 |
|
| PDBID: | 8whg | | Status: | HPUB -- hold until publication | | Title: | imine reductase mutant - M3 | | Authors: | Zhu, X.X., Chen, X.R., Zheng, G.W. | | Deposition date: | 2023-09-23 |
|
| PDBID: | 9jgj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-07 |
|
| PDBID: | 9cmj | | Status: | HPUB -- hold until publication | | Title: | Room-temperature X-ray structure of SARS-CoV-2 main protease drug resistant mutant (L50F, E166V) | | Authors: | Kovalevsky, A., Coates, L., Gerlits, O. | | Deposition date: | 2024-07-15 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMFNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMVLPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 8whf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 9jgk | | Status: | PROC -- to be processed | | Title: | cryo-EM structure of 5-Hydroxytryptamine 2B Receptor in complex with balovaptan | | Authors: | Kaixuan, G., Xin, Z., Xiangyu, L. | | Deposition date: | 2024-09-07 |
|
