| PDBID: | 9btt | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor SR-B-51T | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-15 | | Release date: | 2025-05-15 |
|
| PDBID: | 9btu | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8wna | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-05 |
|
| PDBID: | 9btx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9bty | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9btz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9bu5 | | Status: | HPUB -- hold until publication | | Title: | CC ProXp-ala apo solution structure | | Authors: | Duran, A.D., Foster, M.P. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8wnv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the dimethylamine methyltransferase MtbB at 2.4 A | | Authors: | Li, J., Chan, M.K. | | Deposition date: | 2023-10-06 |
|
| PDBID: | 9bu7 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of AAV2 Rep68 bound to integration site AAVS1: Insights into the mechanism of DNA melting. | | Authors: | Escalante, C.R. | | Deposition date: | 2024-05-16 | | Sequence: | >Entity 1
GPPGFYEIVIKVPSDLDGHLPGISDSFVNWVAEKEWELPPDSDMDLNLIEQAPLTVAEKLQRDFLTEWRRVSKAPEALFFVQFEKGESYFHMHVLVETTGVKSMVLGRFLSQIREKLIQRIYRGIEPTLPNWFAVTKTRNGAGGGNKVVDESYIPNYLLPKTQPELQWAWTNMEQYLSACLNLTERKRLVAQHLTHVSQTQEQNKENQNPNSDAPVIRSKTSARYMELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAPDYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGG
>Entity 2
(DG)(DT)(DT)(DG)(DG)(DG)(DG)(DC)(DT)(DC)(DG)(DG)(DC)(DG)(DC)(DT)(DC)(DG)(DC)(DT)(DC)
>Entity 3
(DG)(DA)(DG)(DC)(DG)(DA)(DG)(DC)(DG)(DC)(DC)(DG)(DA)(DG)(DC)(DC)(DC)(DC)(DA)(DA)(DC)
|
|
| PDBID: | 8wnx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of dimethylamine-bound MtbB at 2.7 A | | Authors: | Li, J., Chan, M.K. | | Deposition date: | 2023-10-06 |
|
| PDBID: | 9bu4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of an MKP5 mutant, Y435W, in complex with an allosteric inhibitor | | Authors: | Manjula, R., Bennett, A.M., Lolis, E. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8woa | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-06 |
|
| PDBID: | 9bu9 | | Status: | HPUB -- hold until publication | | Title: | Mixed-valent (2/3) dimanganese SfbO | | Authors: | Liu, C., Rittle, J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8wo5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-06 |
|
| PDBID: | 9bua | | Status: | HPUB -- hold until publication | | Title: | SfbO reconstituted with Mn(II) anaerobically | | Authors: | Liu, C., Rittle, J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bub | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8wnm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-06 |
|
| PDBID: | 9bu2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8wno | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-06 |
|
| PDBID: | 9buc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8wok | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-07 | | Release date: | 2024-10-07 |
|
| PDBID: | 9bue | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human calcitonin Receptor in complex with Gs and cagrilintide in the CT-like conformation (repeat) | | Authors: | Cao, J., Belousoff, M.J., Johnson, R.M., Sexton, P.M., Wootten, D.L. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8won | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the 10-subunits Mmp1 complex from Mycobacterium smegmatis | | Authors: | Zhang, M., Tang, Y., Gao, Y., Liu, X., Lan, W., Liu, Y., Ma, M. | | Deposition date: | 2023-10-07 | | Release date: | 2025-04-07 |
|
| PDBID: | 9bu8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8woc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-07 |
|
