PDBID: | 7gvu | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9bd2 | Status: | AUTH -- processed, waiting for author review and approval | Title: | MAGE-A3 MHD crystal soaked with KL861 | Authors: | Butrin, A., Crews, C. | Deposition date: | 2024-04-10 |
|
PDBID: | 8vb7 | Status: | HPUB -- hold until publication | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | Deposition date: | 2023-12-12 |
|
PDBID: | 7gvv | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9bdg | Status: | HPUB -- hold until publication | Title: | Influenza A virus Hemagglutinin H3/Darwin/6/2021 in complex with Fab ADI-85647 | Authors: | Ferreira Ramos, A.S., Bajic, G. | Deposition date: | 2024-04-11 |
|
PDBID: | 8vbh | Status: | HPUB -- hold until publication | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | Deposition date: | 2023-12-12 |
|
PDBID: | 7gvw | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9bdf | Status: | HPUB -- hold until publication | Title: | Influenza A virus Hemagglutinin H3/Darwin/6/2021 in complex with Fab ADI-85666 | Authors: | Ferreira Ramos, A.S., Bajic, G. | Deposition date: | 2024-04-11 |
|
PDBID: | 8vb9 | Status: | HPUB -- hold until publication | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | Deposition date: | 2023-12-12 |
|
PDBID: | 7gvx | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9bd9 | Status: | AUTH -- processed, waiting for author review and approval | Title: | SARS CoV-2 full-length spike protein, 1RBD-up conformation | Authors: | Singh, S., Hasan, S.S. | Deposition date: | 2024-04-11 |
|
PDBID: | 8vbg | Status: | HPUB -- hold until publication | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | Deposition date: | 2023-12-12 |
|
PDBID: | 7gvy | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9bd5 | Status: | HPUB -- hold until publication | Title: | Laccase from Bacillus licheniformis | Authors: | Habib, M.H., Smith, T.J. | Deposition date: | 2024-04-11 | Sequence: | >Entity 1 MKLEKFVDKLPIPKVLKPHSKSKEMTYYEVTMKEFQQQLHRDLPPTRLFGYNGVYPGPTFEVQKHEKVAVKWLNKLPDHHFLPVDHTIHDDGHHEHEVKTVVHLHGGRTPPDSDGYPEAWYTKDFQVKGPFFEREVYEYPNEQDATALWYHDHAMAITRLNVYAGLVGLYFIRDREERSLNLPKGEYEIPLLIQDKSFHEDGSLFYPRQPDNPSPDLPDPSIVPAFCGDTILVNGKVWPYDELEPRKYRFRILNASNTRIFELYFDHDITFHQIGTDGGLLQHPVKVNELVIAPAERCDIIVDFSRAEGKTVTLKNRIGCSGQDADPDTDANIMQFRISKPLKQKDTSSLPRILRKRPFYRRHKINTLRNLSLGASLDQYGRPVLLLNNTKWHEPVTETPALGSTEIWSIINAGRAIHPIHLHLVQFLILDHRPFDIERYQENGELVFTGPAAPPAQNEKGLKDTVKVPPGSVTRIIATFAPYSGRYVWHCHILEHEDYDMMRPLEVTDIRHQEFEAWARTKTHLRRGSE
|
|
PDBID: | 8vbc | Status: | HPUB -- hold until publication | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | Deposition date: | 2023-12-12 |
|
PDBID: | 7gvz | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9bdb | Status: | HPUB -- hold until publication | Title: | Bacillus anthracis BxpB homotrimer in complex with BclA NTD peptide | Authors: | Schormann, N., Green, T., Turnbough, C.L. | Deposition date: | 2024-04-11 | Sequence: | >Entity 1 MFSSDCEFTKIDCEAKPASTLPAFGFAFNASAPQFASLFTPLLLPSVSPNPNITVPVINDTVSVGDGIRILRAGIYQISYTLTISLDNSPVAPEAGRFFLSLGTPANIIPGSGTAVRSNVIGTGEVDVSSGVILINLNPGDLIRIVPVELIGTVDIRAAALTVAQIS
>Entity 2 AFDPNLVGPTLPPIPPFTL
|
|
PDBID: | 8vbi | Status: | HPUB -- hold until publication | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | Deposition date: | 2023-12-12 |
|
PDBID: | 7gw0 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9bda | Status: | HPUB -- hold until publication | Title: | Bacillus anthracis BxpB homotrimer in complex with BclA NTD peptide | Authors: | Schormann, N., Green, T., Turnbough, C.L. | Deposition date: | 2024-04-11 | Sequence: | >Entity 1 MFSSDCEFTKIDCEAKPASTLPAFGFAFNASAPQFASLFTPLLLPSVSPNPNITVPVINDTVSVGDGIRILRAGIYQISYTLTISLDNSPVAPEAGRFFLSLGTPANIIPGSGTAVRSNVIGTGEVDVSSGVILINLNPGDLIRIVPVELIGTVDIRAAALTVAQIS
>Entity 2 AFDPNLVGPTLPPIPPFTL
|
|
PDBID: | 8vbd | Status: | HPUB -- hold until publication | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | Deposition date: | 2023-12-12 |
|
PDBID: | 7gw1 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9bdd | Status: | HPUB -- hold until publication | Title: | Cryo-EM Structure of Non-Cognate Substrate Bound in the Entry Site (ES) of Human Mitochondrial Transcription Elongation Complex | Authors: | Herbine, K.H., Nayak, A.R., Temiakov, D. | Deposition date: | 2024-04-11 |
|
PDBID: | 8vbe | Status: | HPUB -- hold until publication | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | Deposition date: | 2023-12-12 |
|
PDBID: | 7gw2 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|