PDBID: | 7gvc | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9bcf | Status: | HPUB -- hold until publication | Title: | Chimeric protein of crocodile allergen Cro p 1.0101 and GFP | Authors: | O''Malley, A., Ruethers, T., Lopata, A.L., Chruszcz, M. | Deposition date: | 2024-04-09 |
|
PDBID: | 8va3 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-11 |
|
PDBID: | 7gvd | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9bch | Status: | HPUB -- hold until publication | Title: | Solution structure of the hemoglobin receptor HbpA from Corynebacterium diphtheriae | Authors: | Mahoney, B.J., Clubb, R.T. | Deposition date: | 2024-04-09 | Sequence: | >Entity 1 SEEVKNADLYWGFSGSSHHKYDHNGPKFEKAGKGAELTNIDAASAYAETFKKGVFPNNKREKSDILVFHNGEVKTETNHSSYQINWPGEVTMKLGYGDGLVIKDLNLMLKNGNMGELKATVGENSNITLFDVQEYSVSDNTITVTPKIPPCTTGTWKPWHNDLTSKLGSLKSVFFESYTCNNDDIAKKPLPLTVVLNG
|
|
PDBID: | 7gve | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9bcg | Status: | AUTH -- processed, waiting for author review and approval | Title: | Myeloid cell leukemia-1 (Mcl-1) complexed with compound | Authors: | Zhao, B., Fesik, S.W. | Deposition date: | 2024-04-09 |
|
PDBID: | 8vb0 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-11 |
|
PDBID: | 7gvf | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9bcl | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-09 |
|
PDBID: | 8vaj | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-11 |
|
PDBID: | 7gvh | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9bck | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-09 |
|
PDBID: | 8va7 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-11 |
|
PDBID: | 7gvi | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9bcm | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-09 |
|
PDBID: | 8va9 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-11 |
|
PDBID: | 7gvj | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9bcr | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-04-09 | Release date: | 2025-04-09 |
|
PDBID: | 8vab | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-11 |
|
PDBID: | 7gvk | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9bcn | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-09 |
|
PDBID: | 8vah | Status: | HPUB -- hold until publication | Title: | E.coli PNPase in complex with single 8-oxoG RNA | Authors: | Kim, W., Zhang, Y.J. | Deposition date: | 2023-12-11 |
|
PDBID: | 9bcu | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-09 |
|
PDBID: | 7gvl | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|