| PDBID: | 9bwc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-21 |
|
| PDBID: | 7gr5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of PAS-GAF domain of the phytochrome from Deinococcus radiodurans at femto and picosecond timescales (233 fs) | | Authors: | Shankar, M.K., Westenhoff, S. | | Deposition date: | 2023-11-07 |
|
| PDBID: | 8vgo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-27 |
|
| PDBID: | 9j6l | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Solution structure of human Glutathione Peroxidase 4 (Sec73Cys) with eight mutations | | Authors: | Furuita, K., Sugiki, T., Inomata, K., Miyanoiri, Y., Kobayashi, N., Fujiwara, T., Kojima, C. | | Deposition date: | 2024-08-16 |
|
| PDBID: | 9bwe | | Status: | HPUB -- hold until publication | | Title: | Homomeric alpha3 glycine receptor in the presence of 0.1 mM glycine at pH 6.4 in an intermediate state | | Authors: | Kindig, K., Gibbs, E., Chakrapani, S. | | Deposition date: | 2024-05-21 |
|
| PDBID: | 7gr6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of PAS-GAF domain of the phytochrome from Deinococcus radiodurans at femto and picosecond timescales (280 fs) | | Authors: | Shankar, M.K., Westenhoff, S. | | Deposition date: | 2023-11-07 |
|
| PDBID: | 8vga | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-27 |
|
| PDBID: | 9j6h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Complex I from respirasome closed state 1 bound by metformin and CoQ10 (SC-MetC1-iv) | | Authors: | Teng, F., He, Z.X., Hu, Y.Q., Xu, C.Y., Guo, R.Y., Zhou, L. | | Deposition date: | 2024-08-16 |
|
| PDBID: | 9bwj | | Status: | HPUB -- hold until publication | | Title: | Homomeric alpha3 glycine receptor in the presence of 0.1 mM glycine and 0.1 mM zinc in an apo state | | Authors: | Kindig, K., Gibbs, E., Chakrapani, S. | | Deposition date: | 2024-05-21 |
|
| PDBID: | 7gr7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of PAS-GAF domain of the phytochrome from Deinococcus radiodurans at femto and picosecond timescales (295 fs) | | Authors: | Shankar, M.K., Westenhoff, S. | | Deposition date: | 2023-11-07 |
|
| PDBID: | 8vgb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-27 |
|
| PDBID: | 9j6p | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | pre-mir-125a internal loop in complex with G-clamp (Form 1) | | Authors: | Kondo, J., Nagasawa, R., Onizuka, K., Kawamura, K., Tsuzuki, K., Murase, H., Komatsu, K.R., Miyashita, E., Saito, H., Nagatsugi, F. | | Deposition date: | 2024-08-16 |
|
| PDBID: | 9bwk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-21 |
|
| PDBID: | 7gr8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of PAS-GAF domain of the phytochrome from Deinococcus radiodurans at femto and picosecond timescales (344 fs) | | Authors: | Shankar, M.K., Westenhoff, S. | | Deposition date: | 2023-11-07 |
|
| PDBID: | 8vgp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-27 |
|
| PDBID: | 9j6o | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of bromodomain of human CBP in complex with the inhibitor CZL-046 | | Authors: | Zhang, Y., Zhang, C., Chen, Z., Yang, H., Huang, X., Li, Y., Xu, Y. | | Deposition date: | 2024-08-16 |
|
| PDBID: | 9bwm | | Status: | HPUB -- hold until publication | | Title: | Neutron Structure of Oxidized Tyr34Phe MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-05-21 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 7gra | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of PAS-GAF domain of the phytochrome from Deinococcus radiodurans at femto and picosecond timescales (406 fs) | | Authors: | Shankar, M.K., Westenhoff, S. | | Deposition date: | 2023-11-07 |
|
| PDBID: | 8vgq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-27 |
|
| PDBID: | 9j6n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-16 |
|
| PDBID: | 9bwl | | Status: | PROC -- to be processed | | Title: | Crystal structure of polyketoacyl-CoA thiolase from Burkholderia sp in complex with butyryl-coA | | Authors: | Pereira, J.H., Wang, Z., Keasling, J.D., Adams, P.D. | | Deposition date: | 2024-05-21 |
|
| PDBID: | 7grb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of PAS-GAF domain of the phytochrome from Deinococcus radiodurans at femto and picosecond timescales (472 fs) | | Authors: | Shankar, M.K., Westenhoff, S. | | Deposition date: | 2023-11-07 |
|
| PDBID: | 9j6r | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-17 |
|
| PDBID: | 8vgu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of BcTSPO/Hematin complex | | Authors: | Qiu, W., Guo, Y., Hendrickson, W.A. | | Deposition date: | 2023-12-28 |
|
| PDBID: | 9j6s | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-17 |
|
