| PDBID: | 7g6y | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 9bgl | | Status: | AUCO -- author corrections pending review | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8v0d | | Status: | HPUB -- hold until publication | | Title: | Ubch5B-RING3 of MIB1 fusion structure | | Authors: | Cao, R., Blacklow, S.C. | | Deposition date: | 2023-11-17 |
|
| PDBID: | 7g6z | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 9bgu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8v0c | | Status: | HPUB -- hold until publication | | Title: | Structure of TDP1 catalytic domain complexed with compound IB06 | | Authors: | Lountos, G.T., Zhao, X.Z., Barakat, I., Wang, W., Agama, K., Al Mahmud, M.R., Pommier, Y., Burke Jr., T.R. | | Deposition date: | 2023-11-17 |
|
| PDBID: | 7g70 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 9bgx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8v0b | | Status: | HPUB -- hold until publication | | Title: | Structure of TDP1 catalytic domain complexed with compound IB05 | | Authors: | Lountos, G.T., Zhao, X.Z., Barakat, I., Wang, W., Agama, K., Al Mahmud, M.R., Pommier, Y., Burke Jr., T.R. | | Deposition date: | 2023-11-17 |
|
| PDBID: | 7g71 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 9bh4 | | Status: | HPUB -- hold until publication | | Title: | PRMT1 hexamer, Protein Arginine Methyl transferase | | Authors: | Nadendla, E.K., Wang, C.H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8v0j | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-17 |
|
| PDBID: | 7g74 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 9bhe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7g76 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8v17 | | Status: | HPUB -- hold until publication | | Title: | HIV-CA Disulfide linked Hexamer with inhibitor bound - exploration of a benzothiazole | | Authors: | Goldstone, D.C., Walsham, L.J. | | Deposition date: | 2023-11-19 | | Sequence: | >Entity 1
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKAR
|
|
| PDBID: | 9bhb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7g77 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8v1n | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of tau filaments made from jR2R3-P301L peptides induced with heparin | | Authors: | Vigers, M., Han, S. | | Deposition date: | 2023-11-20 |
|
| PDBID: | 9bhd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PRMT1-Octamer | | Authors: | Nadendla, E.K., Wang, C.H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7g78 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8v18 | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with 8-oxoguanine with bound AMPCPP | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2023-11-20 |
|
| PDBID: | 9bhf | | Status: | HPUB -- hold until publication | | Title: | Structure of apo Aggregatibacter actinomycetemcomitans SiaP protein | | Authors: | King-Hudson, T.-R.J., Davies, J.S., Dobson, R.C.J. | | Deposition date: | 2024-04-20 |
|
| PDBID: | 7g79 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8v19 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | RNA polymerase II elongation complex with Syn conformation 8-oxoguanine with AMP added | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2023-11-20 |
|
