PDBID: | 8zh9 | Status: | HPUB -- hold until publication | Title: | The structure of ELK1-DNA complex | Authors: | Liu, G., Sun, L.T. | Deposition date: | 2024-05-10 |
|
PDBID: | 8rw1 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-02 |
|
PDBID: | 7g2l | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-06-05 | Release date: | 2024-12-07 |
|
PDBID: | 8zh6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-10 |
|
PDBID: | 8rw4 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 7g2m | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-06-05 | Release date: | 2024-12-07 |
|
PDBID: | 8zgz | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of inward state Anhydromuropeptide permease (AmpG) | Authors: | Cho, H.S., Kim, U., Chang, N., Kim, H., Yoo, Y. | Deposition date: | 2024-05-10 |
|
PDBID: | 8rw7 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 7g2n | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-06-05 | Release date: | 2024-12-07 |
|
PDBID: | 8zhd | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-10 |
|
PDBID: | 8rwc | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 7g2o | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-06-05 | Release date: | 2024-12-07 |
|
PDBID: | 8zh2 | Status: | HPUB -- hold until publication | Title: | Fe(II)/(alpha)ketoglutarate-dependent dioxygenase cnsJ with a-ketoglutarate and Communesin K | Authors: | Wang, J., Wang, X.Y., Yan, W.P. | Deposition date: | 2024-05-10 |
|
PDBID: | 8rw9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 | Sequence: | >Entity 1 QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYPMSWVRQAPGKGLEWVSDINSSGTTYYADSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCATEGKYGRTWYGQLEYHYWGQGTQVTVSEHHHHHH
>Entity 2 MHHHHHHESAKAVTTQKVEVKFSKAVEKLTKEDIKVTNKANNDKVLVKEVTLSEDKKSATVELYSNLAAKQTYTVDVNKVGKTEVAVGSLEAKTIEMADQTVVADEPTALQFTVKDENGTEVVSPEGIEFVTPAAEKINAKGEITLAKGTSTTVKAVYKKDGKVVAESKEVKVSAE
|
|
PDBID: | 7g2p | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-06-05 | Release date: | 2024-12-07 |
|
PDBID: | 8zgy | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-10 |
|
PDBID: | 8rw6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 7g2q | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-06-05 | Release date: | 2024-12-07 |
|
PDBID: | 8zgx | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-10 |
|
PDBID: | 7g31 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-06-05 | Release date: | 2024-12-07 |
|
PDBID: | 8zh3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-10 |
|
PDBID: | 8rwb | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-02 |
|
PDBID: | 7g32 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-06-05 | Release date: | 2024-12-07 |
|
PDBID: | 8zhb | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-10 |
|
PDBID: | 8rwd | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-03 |
|