| PDBID: | 8zge | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-09 |
|
| PDBID: | 7g2a | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of liver pyruvate kinase in complex with allosteric activator 8e | | Authors: | Lulla, A., Monjas Gomez, L., Rodriquez Riveiro, A., Grotli, M., Hyvonen, M. | | Deposition date: | 2023-05-18 |
|
| PDBID: | 8txj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-23 |
|
| PDBID: | 8zgg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-09 |
|
| PDBID: | 7g2b | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of liver pyruvate kinase in complex with allosteric activator 8f | | Authors: | Lulla, A., Monjas Gomez, L., Rodriquez Riveiro, A., Grotli, M., Hyvonen, M. | | Deposition date: | 2023-05-18 |
|
| PDBID: | 8tyg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-25 |
|
| PDBID: | 7g2c | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of liver pyruvate kinase in complex with allosteric activator 8g | | Authors: | Lulla, A., Monjas Gomez, L., Rodriquez Riveiro, A., Grotli, M., Hyvonen, M. | | Deposition date: | 2023-05-18 |
|
| PDBID: | 8zgh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-09 |
|
| PDBID: | 8u0e | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-29 |
|
| PDBID: | 7g2d | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of liver pyruvate kinase in complex with allosteric activator 8h | | Authors: | Lulla, A., Monjas Gomez, L., Rodriquez Riveiro, A., Grotli, M., Hyvonen, M. | | Deposition date: | 2023-05-18 |
|
| PDBID: | 8zgu | | Status: | HPUB -- hold until publication | | Title: | Crystal structural of HTNV Gn and AH100 Fab | | Authors: | Wang, F.R., Wu, Y., Gao, F. | | Deposition date: | 2024-05-09 |
|
| PDBID: | 8tjs | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-24 |
|
| PDBID: | 8zgw | | Status: | HPUB -- hold until publication | | Title: | Drimenyl diphosphate synthase SsDMS_F248Y&D303E from Streptomyces showdoensis in complex with farnesyl diphosphate (FPP) and Mg2+ | | Authors: | Pan, X.M., Dong, S.M., Dong, L.B. | | Deposition date: | 2024-05-09 |
|
| PDBID: | 7g2g | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8u9s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-20 |
|
| PDBID: | 8z5q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 7g2h | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8tcb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-30 | | Release date: | 2024-12-30 |
|
| PDBID: | 7g2i | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8zh0 | | Status: | HPUB -- hold until publication | | Title: | Fe(II)/(alpha)ketoglutarate-dependent dioxygenase cnsJ with metal Iron | | Authors: | Wang, J., Wang, X.Y., Yan, W.P. | | Deposition date: | 2024-05-10 | | Sequence: | >Entity 1
MGSSWSHPQFEKMSTVDTAPQSHYQETKVSEIPIVILKSSATDDVAAHEAIEALKVAGVCIVRNLLDRSTVDKVRQELQPYDKQADSFEGFPKNYCQVAGLLSKSPTYAHSIVGNKLFTAVRNYFLTSTYECWAEKGTWMSVKSPPQLDSTLALYVNPGSGDQGLHRDDATQQNWNSGASEYSLGRDSGCAMMVALTECAREDGTTRFIPGSHLWDYQYDHPSNDDPRIRYAEMRPGDAYLMLSSVIHAGSVNYSTDRRRVLAAVFAARSHLRQVENQYLTYDIETVRTFPTWLQRFMGYSLSKLFQGWVDKKDPLLVVDPNAQPEGEDDGGMKPNEGEHVVEAQI
|
|
| PDBID: | 8tp0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 |
|
| PDBID: | 7g2j | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8zh1 | | Status: | HPUB -- hold until publication | | Title: | Fe(II)/(alpha)ketoglutarate-dependent dioxygenase cnsJ with a-ketoglutarate | | Authors: | Wang, J., Wang, X.Y., Yan, W.P. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8trp | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-10 | | Release date: | 2024-08-10 |
|
| PDBID: | 7g2k | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
