| PDBID: | 8zdd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-01 |
|
| PDBID: | 8u0c | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-29 |
|
| PDBID: | 8zd7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-01 | | Sequence: | >Entity 1
(DC)(DT)(DA)(DA)(DC)(DG)(DG)(DA)(DA)(DT)(DG)
>Entity 2
(DC)(DA)(DT)(DT)(DC)(DG)(DG)(DT)(DT)(DA)(DG)
|
|
| PDBID: | 8u0d | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-29 |
|
| PDBID: | 8zd8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-01 | | Sequence: | >Entity 1
(DC)(DT)(DA)(DA)(DC)(DG)(DG)(DA)(DA)(DT)(DG)
>Entity 2
(DC)(DA)(DT)(DT)(DC)(DG)(DG)(DT)(DT)(DA)(DG)
|
|
| PDBID: | 8u0h | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-29 |
|
| PDBID: | 8u0r | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of protein A21, a component of the conserved poxvirus entry-fusion complex | | Authors: | Diesterbeck, U., Gittis, A.G., Garboczi, D.N., Moss, B. | | Deposition date: | 2023-08-29 |
|
| PDBID: | 8zdh | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacteriophage Douge genome-packed capsid (GP8 and GP113) | | Authors: | Maharana, J., Wang, C.H., Tsai, L.A., Lowary, T.L., Ho, M.C. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8zdi | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacteriophage Douge genome-released capsid (GP8) | | Authors: | Maharana, J., Wang, C.H., Tsai, L.A., Lowary, T.L., Ho, M.C. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8u1b | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-31 |
|
| PDBID: | 8zdj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8u1a | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-31 |
|
| PDBID: | 8zdk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8u1p | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-01 |
|
| PDBID: | 8zdl | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacteriophage Douge genome-released connector (GP5, GP9, GP10, GP12 and GP13) | | Authors: | Maharana, J., Wang, C.H., Tsai, L.A., Lowary, T.L., Ho, M.C. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8u1h | | Status: | HPUB -- hold until publication | | Title: | Axle-less Bacillus sp. PS3 F1 ATPase mutant | | Authors: | Furlong, E.J., Zeng, Y.C., Brown, S.H.J., Sobti, M., Stewart, A.G. | | Deposition date: | 2023-09-01 |
|
| PDBID: | 8zdm | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacteriophage Douge genome-released vertex (GP8) | | Authors: | Maharana, J., Wang, C.H., Tsai, L.A., Lowary, T.L., Ho, M.C. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8u1z | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-04 | | Release date: | 2024-09-04 |
|
| PDBID: | 8zdn | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacteriophage Douge genome-released tail tube (GP13) | | Authors: | Maharana, J., Wang, C.H., Tsai, L.A., Lowary, T.L., Ho, M.C. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8u25 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Main Protease (Mpro) L50F/E166A/L167F Triple Mutant | | Authors: | Kohaal, N., Lewandowski, E.M., Wang, J., Chen, Y. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8zdo | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacteriophage Douge baseplate (GP13, GP17, GP23, GP16, GP18, and GP20) | | Authors: | Maharana, J., Wang, C.H., Tsai, L.A., Lowary, T.L., Ho, M.C. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8u2a | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-05 | | Release date: | 2024-09-05 |
|
| PDBID: | 8zdp | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacteriophage Douge Central fiber (GP20) | | Authors: | Maharana, J., Wang, C.H., Tsai, L.A., Lowary, T.L., Ho, M.C. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8u2l | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KAI2 S95C L48I mutant | | Authors: | Davies, S.F., Waters, M.T., Bond, C.S. | | Deposition date: | 2023-09-06 | | Sequence: | >Entity 1
GVVEEAHNVKVIGSGEATIVLGHGFGTDQSVWKHLVPHLVDDYRVVIYDNMGAGTTNPDYFDFDRYSNLEGYSFDLIAILEDLKIESCIFVGH(OCS)VSAMIGVLASLNRPDLFSKIVMISASPRYVNDVDYQGGFEQEDLNQLFEAIRSNYKAWCLGFAPLAVGGDMDSIAVQEFSRTLFNMRPDIALSVGQTIFQSDMRQILPFVTVPCHILQSVKDLAVPVVVSEYLHANLGCESVVEVIPSDGHLPQLSSPDSVIPVILRHIRNDI
|
|
| PDBID: | 8zdq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Mycobacteriophage Douge complete baseplate (GP13, GP17, GP23, GP16, GP18, and GP20) | | Authors: | Maharana, J., Wang, C.H., Tsai, L.A., Lowary, T.L., Ho, M.C. | | Deposition date: | 2024-05-02 |
|
