PDBID: | 8tqj | Status: | HPUB -- hold until publication | Title: | MPI57 bound to Mpro of SARS-CoV-2 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2023-08-07 |
|
PDBID: | 8z8m | Status: | HPUB -- hold until publication | Title: | Crystal structure of human TNF alpha in complex with TNF30(VHH) domain of ozoralizumab | Authors: | Mima, M., Mishima-Tsumagari, C. | Deposition date: | 2024-04-22 |
|
PDBID: | 8tql | Status: | HPUB -- hold until publication | Title: | MPI54 bound to Mpro of SARS-CoV-2 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2023-08-07 |
|
PDBID: | 8z8v | Status: | HPUB -- hold until publication | Title: | Crystal structure of human serum albumin in complex with ALB8(VHH) domain of ozoralizumab | Authors: | Mima, M., Mishima-Tsumagari, C. | Deposition date: | 2024-04-22 |
|
PDBID: | 8tqq | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-08 | Release date: | 2024-08-08 |
|
PDBID: | 8z8w | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-22 |
|
PDBID: | 8tqr | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-08 | Release date: | 2024-08-08 |
|
PDBID: | 8z93 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of amyloid fibril formed by human RIPK1 RHIM protein | Authors: | Ma, Y., Zhao, K., Liu, C. | Deposition date: | 2024-04-22 |
|
PDBID: | 8tqn | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-08 | Release date: | 2024-08-08 |
|
PDBID: | 8z94 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of RIPK1 RHIM PFFs cross seeded RIPK3 RHIM amyloid fibril | Authors: | Ma, Y., Zhao, K., Liu, C. | Deposition date: | 2024-04-22 |
|
PDBID: | 8tqy | Status: | HPUB -- hold until publication | Title: | X-Ray Crystal Structure of a dihydromethanopterin reductase (DmrA) from Methylobacterium extorquens AM1 in a H32 Spacegroup at 2.19 Angstrom Resolution | Authors: | Axelrod, H.L., Rasche, M.E., Cascio, D., Arbig, M., Collazo, M., Potla, P.S. | Deposition date: | 2023-08-08 | Release date: | 2025-01-08 | Sequence: | >Entity 1 MIDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALTMGHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
PDBID: | 8z9x | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-23 |
|
PDBID: | 8tqw | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-08 |
|
PDBID: | 8z9n | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-23 |
|
PDBID: | 8tqt | Status: | HPUB -- hold until publication | Title: | MPI52 bound to Mpro of SARS-CoV-2 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2023-08-08 |
|
PDBID: | 8z9o | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-23 |
|
PDBID: | 8tr7 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-09 |
|
PDBID: | 8z9p | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-23 |
|
PDBID: | 8tra | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 |
|
PDBID: | 8z9g | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-23 |
|
PDBID: | 8trb | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-09 |
|
PDBID: | 8z9f | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-23 |
|
PDBID: | 8trk | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 |
|
PDBID: | 8z9m | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-23 |
|
PDBID: | 8trj | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 |
|