| PDBID: | 8iz2 | | Status: | HOLD -- hold until a certain date | | Title: | Single excitation and two emissions pH sensor protein (SITE-pHorin)_C203E_pH8.0 | | Authors: | Kang, J.S., Li, S.A. | | Deposition date: | 2023-04-06 | | Release date: | 2024-10-06 |
|
| PDBID: | 9dcj | | Status: | PROC -- to be processed | | Deposition date: | 2024-08-26 |
|
| PDBID: | 8yii | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8iyv | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of trypsin-famotidine complex at 2.10 Angstroms resolution | | Authors: | Ahmad, M.S., Kalam, N., Akbar, Z., Rasheed, S., Choudhary, M.I. | | Deposition date: | 2023-04-06 | | Release date: | 2024-10-06 |
|
| PDBID: | 9dck | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The complex structure of cGAS with BuDNA (bubble DNA) | | Authors: | Wu, S., Sohn, J. | | Deposition date: | 2024-08-26 |
|
| PDBID: | 8yia | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 9dce | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-26 |
|
| PDBID: | 8yij | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 9dcf | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-08-26 |
|
| PDBID: | 8yil | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in YF24228-bound state | | Authors: | Ye, Y., Li, Z.W., Yang, G.F. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 9dci | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-26 |
|
| PDBID: | 8yin | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in YF23694-bound state | | Authors: | Ye, Y., Li, Z.W., Yang, G.F. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yiv | | Status: | HPUB -- hold until publication | | Title: | N17.1.2 recognition of NRAS neoantigens | | Authors: | Wu, D.C., Mariuzza, R.A. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 9dch | | Status: | PROC -- to be processed | | Title: | Single-stranded RNA-mediated PRC2 dimer | | Authors: | Song, J.S., Kasinath, V.K. | | Deposition date: | 2024-08-26 |
|
| PDBID: | 9dcl | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-26 |
|
| PDBID: | 8yj2 | | Status: | HPUB -- hold until publication | | Title: | N17.1.2 recognition of NRAS neoantigens | | Authors: | Wu, D.C., Mariuzza, R.A. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 9etc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of recombinant chicken liver Bile Acid Binding Protein (cL-BABP) in complex with chenodeoxycholic acid | | Authors: | Tassone, G., Pozzi, C. | | Deposition date: | 2024-03-26 | | Sequence: | >Entity 1
GSHMAFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQEVKGNEMVETITFGGVTLIRRSKRV
|
|
| PDBID: | 8yj3 | | Status: | HPUB -- hold until publication | | Title: | N17.1.2 recognition of NRAS neoantigens | | Authors: | Wu, D.C., Mariuzza, R.A. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 9eth | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8yje | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-01 |
|
| PDBID: | 9dct | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-27 |
|
| PDBID: | 8yj9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-01 |
|
| PDBID: | 9dcs | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-27 |
|
| PDBID: | 8yjb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-01 |
|
| PDBID: | 9dcr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the TelA-associated type VII secretion system chaperone SIR_0168 | | Authors: | Gkragkopoulou, P., Kim, Y., Whitney, J.C. | | Deposition date: | 2024-08-27 |
|
