| PDBID: | 8rh7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8yok | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-13 |
|
| PDBID: | 9fxq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Ancestral Prenylcysteine Oxidase 1 (PCYOX1) | | Authors: | Barone, M., Mattevi, A. | | Deposition date: | 2024-07-02 |
|
| PDBID: | 8rh8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8yob | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-13 |
|
| PDBID: | 9fxr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of trans-o-hydroxybenzylidenepyruvate hydratase-aldolase from Pseudomonas fluorescens N3 bound to pyruvate | | Authors: | Milani, M., Ferrara, S. | | Deposition date: | 2024-07-02 |
|
| PDBID: | 8rha | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 9fxs | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-02 |
|
| PDBID: | 8yog | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-13 |
|
| PDBID: | 8rh9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8yoe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-13 |
|
| PDBID: | 9fy4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Heme-Oxygenase mutant I143K from Corynebacterium diphtheriae complexed with Cobalt-porphyrine (HumO-Co(III)) | | Authors: | Labidi, R.J., Faivre, B., Carpentier, P., Perard, J., Gotico, P., Li, Y., Atta, M., Fontecave, M. | | Deposition date: | 2024-07-02 |
|
| PDBID: | 8rhg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8yof | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-13 |
|
| PDBID: | 9fxp | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-02 |
|
| PDBID: | 8rhh | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8yoi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-13 |
|
| PDBID: | 9fy0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Saccharolobus solfataricus 30S initiation complex bound to Ss-aIF2beta leaderless mRNA | | Authors: | Bourgeois, G., Coureux, P.D., Mechulam, Y., Schmitt, E. | | Deposition date: | 2024-07-02 |
|
| PDBID: | 8rho | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8yoj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-13 |
|
| PDBID: | 9fy5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CRYSTAL STRUCTURE OF HUMAN MONOACYLGLYCEROL LIPASE WITH COMPOUND | | Authors: | Gazzi, T., Grether, U., Nazare, M., Hochstrasser, R., Wang, H., Heer, D., Topp, A., Benz, J. | | Deposition date: | 2024-07-02 |
|
| PDBID: | 8rhp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 9im4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of AF9 YEATS domain F28R mutant in complex with histone H3K9la | | Authors: | Li, H.T., Ma, H.D. | | Deposition date: | 2024-07-02 |
|
| PDBID: | 8yo9 | | Status: | HPUB -- hold until publication | | Title: | structure of phage T4 topoisomerase II gp52 subunit WHD-open state | | Authors: | Chen, Y.T., Xin, Y.H., Xian, R.Q. | | Deposition date: | 2024-03-13 |
|
| PDBID: | 8rhy | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Trypanosoma brucei PTR1 in complex with the cofactor and inhibitor P34 | | Authors: | Pozzi, C., Mangani, S., Landi, G. | | Deposition date: | 2023-12-17 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
