| PDBID: | 9iom | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-09 |
|
| PDBID: | 8rw7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8zcc | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of HCoV-NL63 main protease with X77 | | Authors: | Xu, J., Li, W.W., Yin, X.S., Li, J. | | Deposition date: | 2024-04-29 | | Release date: | 2025-04-29 |
|
| PDBID: | 9ioq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-09 |
|
| PDBID: | 8rwc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8zcg | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-29 |
|
| PDBID: | 9iof | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Escherichia coli Acetyl-coenzyme A Carboxylase Inter-ring Interface (BC Complex) | | Authors: | Ng, J.C.H., Wen, X.K., Leung, S.K.P., Wang, J.Z.K., Lau, W.C.Y. | | Deposition date: | 2024-07-09 |
|
| PDBID: | 8rvr | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Trypanosoma congolense pyruvate kinase in complex with a single-domain antibody (TcoPYK-sdAb42) in the presence of sulfate | | Authors: | Sterckx, Y.G.-J. | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8zch | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-29 |
|
| PDBID: | 9iog | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Escherichia coli Acetyl-coenzyme A Carboxylase Inter-ring Interface (CT Complex) | | Authors: | Ng, J.C.H., Wen, X.K., Leung, S.K.P., Wang, J.Z.K., Lau, W.C.Y. | | Deposition date: | 2024-07-09 |
|
| PDBID: | 8rw9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 | | Sequence: | >Entity 1
QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYPMSWVRQAPGKGLEWVSDINSSGTTYYADSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCATEGKYGRTWYGQLEYHYWGQGTQVTVSEHHHHHH
>Entity 2
MHHHHHHESAKAVTTQKVEVKFSKAVEKLTKEDIKVTNKANNDKVLVKEVTLSEDKKSATVELYSNLAAKQTYTVDVNKVGKTEVAVGSLEAKTIEMADQTVVADEPTALQFTVKDENGTEVVSPEGIEFVTPAAEKINAKGEITLAKGTSTTVKAVYKKDGKVVAESKEVKVSAE
|
|
| PDBID: | 8zcr | | Status: | HPUB -- hold until publication | | Title: | Structure of PI9 | | Authors: | Zhou, A., Yan, T. | | Deposition date: | 2024-04-30 |
|
| PDBID: | 9ioi | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Escherichia coli Acetyl-coenzyme A Carboxylase Diagonal CT Interface | | Authors: | Ng, J.C.H., Wen, X.K., Leung, S.K.P., Wang, J.Z.K., Lau, W.C.Y. | | Deposition date: | 2024-07-09 |
|
| PDBID: | 8rvz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8zcu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 |
|
| PDBID: | 9ioo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Escherichia coli Acetyl-coenzyme A Carboxylase Protomer Complex (Double Ring Conformer 1) | | Authors: | Ng, J.C.H., Wen, X.K., Leung, S.K.P., Wang, J.Z.K., Lau, W.C.Y. | | Deposition date: | 2024-07-09 |
|
| PDBID: | 8rw6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8zcy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 |
|
| PDBID: | 9ior | | Status: | HOLD -- hold until a certain date | | Title: | INTERACTION BETWEEN A FLUOROQUINOLONE DERIVATIVE KG022 AND RNAS: EFFECT OF BASE PAIRS 5'' ADJACENT TO THE BULGE OUT ESIDUES | | Authors: | Ichijo, R., Kawai, G. | | Deposition date: | 2024-07-09 | | Release date: | 2025-07-09 |
|
| PDBID: | 8zcz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 |
|
| PDBID: | 9ios | | Status: | HOLD -- hold until a certain date | | Title: | INTERACTION BETWEEN A FLUOROQUINOLONE DERIVATIVE KG022 AND RNAS: EFFECT OF BASE PAIRS 5'' ADJACENT TO THE BULGE OUT ESIDUES | | Authors: | Ichijo, R., Kawai, G. | | Deposition date: | 2024-07-09 | | Release date: | 2025-07-09 |
|
| PDBID: | 8rwb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8zd0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 |
|
| PDBID: | 9iou | | Status: | HOLD -- hold until a certain date | | Title: | INTERACTION BETWEEN A FLUOROQUINOLONE DERIVATIVE KG022 AND RNAS: EFFECT OF BASE PAIRS 5'' ADJACENT TO THE BULGE OUT ESIDUES | | Authors: | Ichijo, R., Kawai, G. | | Deposition date: | 2024-07-09 | | Release date: | 2025-07-09 |
|
| PDBID: | 8rwd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-03 |
|
