PDBID: | 8yl6 | Status: | HPUB -- hold until publication | Title: | EDS1-SAG101-NRG1A L134E heterotrimer | Authors: | Wu, X.X., Xiao, Y.Y., Wang, Z.Z., Zhang, Y., Wan, L. | Deposition date: | 2024-03-05 |
|
PDBID: | 9il8 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of SME-1 Class A Carbapenemase in complex with Durlobactam | Authors: | Dhankhar, K., Hazra, S. | Deposition date: | 2024-06-29 |
|
PDBID: | 8rba | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8yl7 | Status: | HPUB -- hold until publication | Title: | EDS1-SAG101-NRG1C heterotrimer | Authors: | Wu, X.X., Xiao, Y.Y., Wang, Z.Z., Zhang, Y., Wan, L. | Deposition date: | 2024-03-05 |
|
PDBID: | 9il0 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Uracil-liganded strcuture of Nucleoside hydrolase 1 (NSH1) from Arabidopsis thaliana | Authors: | Byun, S.J., Rhee, S.K. | Deposition date: | 2024-06-29 |
|
PDBID: | 8rbf | Status: | HPUB -- hold until publication | Title: | CryoEM structure of the post-powerstroke actomyosin-5a complex | Authors: | Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D. | Deposition date: | 2023-12-04 |
|
PDBID: | 8yl4 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the de novo designed protein ZZ01 in the crystal form 1 | Authors: | Zhao, Z., Hattori, M. | Deposition date: | 2024-03-05 |
|
PDBID: | 9il9 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of SME-1 carbapenemase in complex with Avibactam. | Authors: | Dhankhar, K., Hazra, S. | Deposition date: | 2024-06-29 |
|
PDBID: | 8rbb | Status: | HPUB -- hold until publication | Title: | p53-Y220C Core Domain Covalently Bound to 2,5,6-trifluoropyridine-3-carbonitrile Soaked at 40 mM | Authors: | Stahlecker, J., Klett, T., Stehle, T., Boeckler, F.M. | Deposition date: | 2023-12-04 |
|
PDBID: | 8yl8 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the de novo designed protein ZZ01 in the crystal form 2 | Authors: | Zhao, Z., Hattori, M. | Deposition date: | 2024-03-05 |
|
PDBID: | 9ikv | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-06-29 |
|
PDBID: | 8rbg | Status: | HPUB -- hold until publication | Title: | CryoEM structure of primed myosin-5a (ADP-Pi state) | Authors: | Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D. | Deposition date: | 2023-12-04 |
|
PDBID: | 8yln | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-06 |
|
PDBID: | 9iky | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of 1-2C-T96F TCR in complex with HLA-A*11:01 bound to KRAS-G12V peptide (VVGAVGVGK) | Authors: | Ma, K.K., Tan, S.G., Gao, G.F., Chai, Y. | Deposition date: | 2024-06-29 |
|
PDBID: | 8rbd | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8ylu | Status: | HPUB -- hold until publication | Title: | structure of phage T6 topoisomerase II central domain bound with DNA | Authors: | Chen, Y.T., Xin, Y.H. | Deposition date: | 2024-03-06 |
|
PDBID: | 9ilg | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-06-29 |
|
PDBID: | 8rbe | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8ylr | Status: | HPUB -- hold until publication | Title: | State 6 (S6) of yeast 80S ribosome bound to 2 tRNAs and eEF2 and eEF3 during tranlocation | Authors: | Cheng, J., Wu, C.L., Li, J.X., Zhang, X.Z. | Deposition date: | 2024-03-06 |
|
PDBID: | 9il7 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of SME E166A in Complex with Ceftaroline Fosamil | Authors: | Dhankhar, K., Hazra, S. | Deposition date: | 2024-06-29 |
|
PDBID: | 8rbl | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8yls | Status: | HOLD -- hold until a certain date | Title: | Structure of SARS-CoV-2 Mpro in complex with its degrader | Authors: | Feng, Y., Li, W., Cheng, S.H., Li, X.B. | Deposition date: | 2024-03-06 | Release date: | 2024-08-28 |
|
PDBID: | 9ikw | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-06-29 |
|
PDBID: | 8rbp | Status: | HPUB -- hold until publication | Title: | Crystal structure of chimeric human carbonic anhydrase IX with 4-chloro-2-(cyclohexylsulfanyl)-N-(2-hydroxyethyl)-5-sulfamoylbenzamide | Authors: | Manakova, E.N., Smirnov, A., Paketuryte, V., Grazulis, S. | Deposition date: | 2023-12-04 | Sequence: | >Entity 1 MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVEFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKALQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
PDBID: | 9ikx | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-06-29 |
|