| PDBID: | 8wkw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-28 |
|
| PDBID: | 8fvo | | Status: | HOLD -- hold until a certain date | | Title: | PCSK9 in complex with an inhibitor | | Authors: | Xu, M., Chopra, R. | | Deposition date: | 2023-01-19 | | Release date: | 2024-08-03 |
|
| PDBID: | 9cv9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Bufavirus 1 at pH 4.0 | | Authors: | Gulkis, M.C., McKenna, R., Bennett, A.D. | | Deposition date: | 2024-07-28 |
|
| PDBID: | 8wkv | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-28 | | Release date: | 2024-09-28 |
|
| PDBID: | 8fvp | | Status: | HOLD -- hold until a certain date | | Title: | PCSK9 in complex with an inhibitor | | Authors: | Xu, M., Chopra, R. | | Deposition date: | 2023-01-19 | | Release date: | 2024-08-03 |
|
| PDBID: | 9cv6 | | Status: | PROC -- to be processed | | Deposition date: | 2024-07-28 |
|
| PDBID: | 8x65 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of X11P(P71T) xylanase from a metagenome derived gene from sugarcane bagasse collection site | | Authors: | Chitnumsub, P., Jaruwat, A., Boonyapakron, K., Prabmark, K. | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MAQQCITSSQTGNHGGYFYSFWTDGGGSVSFCLQNGGRYTSQWSNVGNWVGGKGWQTGGRRVVSYSGTFNTSGNSYLALYGWTTNPLVEYYIVDSWGTWRPPGGEGYMGTVFSDGGWYDVYRTQRVNAPSIEGIRTFYQYWSVRQQKRVGGTITTGNHFDAWASYGMNLGTHNYMVMATEGFQSSGSSDITVSDGGSSSLEHHHHHH
|
|
| PDBID: | 9cvt | | Status: | PROC -- to be processed | | Deposition date: | 2024-07-29 |
|
| PDBID: | 8x4s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8fpa | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Structure of a chimeric antibody (Fab) fragment bound to de-N-acetyl polysialic acid (dPSA) | | Authors: | Beernink, P.T., Agirre, J., Beernink, B.P., Moe, G.R. | | Deposition date: | 2023-01-04 | | Release date: | 2024-07-19 |
|
| PDBID: | 8x4q | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-15 |
|
| PDBID: | 9cwa | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-29 |
|
| PDBID: | 9cwb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-29 |
|
| PDBID: | 8x4x | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-15 |
|
| PDBID: | 9cwc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-29 |
|
| PDBID: | 8wlv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of P122A_Msd in complex with 5-azauracil | | Authors: | Porathoor, S., Anand, R. | | Deposition date: | 2023-10-01 |
|
| PDBID: | 9cwm | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-07-29 |
|
| PDBID: | 8wlt | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-01 |
|
| PDBID: | 9cvd | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-29 |
|
| PDBID: | 8wlw | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of DelP123_Msd in complex with 5-azauracil | | Authors: | Porathoor, S., Anand, R. | | Deposition date: | 2023-10-01 |
|
| PDBID: | 9cwh | | Status: | PROC -- to be processed | | Title: | Crystal structure of DH511.2 antibody bound to germline targeting antigen GT5 | | Authors: | Janus, B.M., Astavans, A., Ofek, G. | | Deposition date: | 2024-07-29 |
|
| PDBID: | 8wlx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of P123A_Msd | | Authors: | Porathoor, S., Anand, R. | | Deposition date: | 2023-10-01 |
|
| PDBID: | 3n0j | | Status: | POLC -- waiting for a policy decision | | Title: | COMMON SOLUTION STRUCTURES OF HOMOZYGOUS Y402 AND H402 ALLOTYPES OF HUMAN COMPLEMENT FACTOR H | | Authors: | PERKINS, S.J., NAN, R., WARD, G., GAVIGAN, L., MILLER, A., GOR, J., MCKAY, A.R., LENGYEL, I. | | Deposition date: | 2010-05-14 |
|
| PDBID: | 9cvi | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of rat neuronal nitric oxide synthase R349A mutant heme domain bound with 4-methyl-6-(3-((methylamino)methyl)phenyl)pyridin-2-amine dihydrochloride | | Authors: | Li, H., Poulos, T.L. | | Deposition date: | 2024-07-29 |
|
| PDBID: | 8wm5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-03 |
|
