| PDBID: | 9fqe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-16 |
|
| PDBID: | 8qdw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-30 |
|
| PDBID: | 8y5w | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-01 |
|
| PDBID: | 9fqd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-16 |
|
| PDBID: | 8qe6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-30 |
|
| PDBID: | 8yll | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-06 |
|
| PDBID: | 9fqq | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-06-17 | | Release date: | 2025-06-17 |
|
| PDBID: | 8qe7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-30 |
|
| PDBID: | 8ylm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-06 |
|
| PDBID: | 9fqo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-17 |
|
| PDBID: | 8qvn | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Cx26 from Gallus Gallus in bicarbonate buffer | | Authors: | Brotherton, D.H., Cameron, A.D. | | Deposition date: | 2023-10-18 | | Sequence: | >Entity 1
MDWGTLQAVLGGVNKHSTSIGKIWLTVLFIFRIMILVVAAERVWGDEQQDFVCNTLQPGCRNVCYDHFFPISHIRLWALQLIFVSTPALLVAMHVAYTRHERKRRFRSGDKINIEELKNEKIHIRGPLWWTYTCSIFFRIVFEAVFMYVFYYMYDGYQMPRLVKCDAWPCPNVVDCFVSRPTEKTTFTIFMLAVSGICMMLNLAELCYLVIKVCLKDSGKTTVLK
|
|
| PDBID: | 8ylp | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-06 | | Release date: | 2025-03-06 |
|
| PDBID: | 9fqf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Studies on chimeric PeAFB | | Authors: | Gallego del Sol, F., Marina, A. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 8qj5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Levansucrase beta from Pseudomonas syringae pv. actinidiae | | Authors: | Ferraroni, M., Peritore, L. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 9fqg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Studies on chimeric PeAFB | | Authors: | Gallego del Sol, F., Marina, A. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 8qie | | Status: | HPUB -- hold until publication | | Title: | CRYO-EM STRUCTURE OF LEISHMANIA MAJOR 80S RIBOSOME : LM32Cs1C1 mutant snoRNA overexpression, class 4 | | Authors: | Rajan, K.S., Yonath, A., Bashan, A. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8ynr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-11 |
|
| PDBID: | 9fqx | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-17 |
|
| PDBID: | 8qp7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Hepatitis C Virus E2 glycoprotein epitopeI 411-424 scaffold design 4CIL_04 | | Authors: | Nagarathinam, K., Cramer, J.T., Krey, T. | | Deposition date: | 2023-09-30 |
|
| PDBID: | 8ynq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-11 |
|
| PDBID: | 9fqn | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of phosphoserine phosphatase (SerB) from Brucella melitensis in complex with L-Ser and Magnesium | | Authors: | Scaillet, T., Wouters, J. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 8qr2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand | | Authors: | Gelin, M., Labesse, G. | | Deposition date: | 2023-10-06 |
|
| PDBID: | 8yns | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-11 |
|
| PDBID: | 9fqk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Perkinsus marinus Respiratory complex II soluble region | | Authors: | Wu, F., Amunts, A. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 8ox3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-04-30 | | Release date: | 2025-01-30 |
|
