| PDBID: | 8zvy | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-12 |
|
| PDBID: | 9g8t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the persulfide dioxygenase (PDO - PA2915) from Pseudomonas aeruginosa | | Authors: | Troilo, F., Giordano, F., Giuffre, A., Giardina, G., Di Matteo, A. | | Deposition date: | 2024-07-24 | | Sequence: | >Entity 1
MLKPDITAFFDPATSTYSYVVRDPSSRACAIVDPVLDYDPAAGRTSHASAERLIAHVRQHDLQVEWLLETHVHADHLSAAIFLQRELGGCLAIGARITQVQAKFSGLFNLGEAFPVDGRQFEHLFEDGESFRIGALECRALHTPGHTPACMTYLVGDSAFVGDTLFMPDYGTARCDFPGGDARQLYRSIQRLFALPDATRLFMCHDYTAPGRDEHRCETSVGEQRRHNVHVREGVDEEAFVAMRQQRDATLGMPTLMLPAIQVNMRGGNLPPVEGNGVRYLKIPLDLFLEHHHHHH
|
|
| PDBID: | 9g91 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 8r7s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8zw8 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of trimethylamine transporter TmaT | | Authors: | Chao, G. | | Deposition date: | 2024-06-12 |
|
| PDBID: | 9g8v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 8r7v | | Status: | HPUB -- hold until publication | | Title: | MutSbeta bound to compound CHDI-00898647 in the canonical DNA-mismatch bound form | | Authors: | Haque, T., Brace, G., Felsenfeld, D., Tilack, K., Schaertl, S., Ballantyne, G., Maillard, M., Iyer, R., Prasad, B., Thomsen, M., Wilkionson, H., Plotnikov, N., Ritzefeld, M. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8zwe | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of NvHKU5r RBD complexed with mink ACE2 | | Authors: | Ji, W., Zhang, S. | | Deposition date: | 2024-06-12 |
|
| PDBID: | 9g99 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Joint neutron and x-ray structure of alginate lyase PsAlg7C soaked with pentamannuronic acid | | Authors: | Wilkens, C., Meilleur, F., Morth, J.P. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 8r7t | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8zwb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-12 |
|
| PDBID: | 9g98 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Joint neutron structure of alginate lyase PsAlg7C soaked with pentamannuronic acid | | Authors: | Wilkens, C., Meilleur, F., Morth, J.P. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 8r7u | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8zw3 | | Status: | HPUB -- hold until publication | | Title: | Solution structure of TMPRSS2 promoter G-quadruplex | | Authors: | Wang, K.B. | | Deposition date: | 2024-06-12 |
|
| PDBID: | 9g97 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 8r89 | | Status: | HPUB -- hold until publication | | Title: | Structure of peptide CpRE12 bound to DPC micelle | | Authors: | Kornilov, F., Taldaev, A., Bashkirov, P., Bocharov, E. | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8zvz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-12 |
|
| PDBID: | 9g8u | | Status: | HPUB -- hold until publication | | Title: | Structure of the LipA:LipB complex from Acinetobacter baumannii | | Authors: | de Oliveira Silva, Y.R., Contreras-Martel, C., Rodrigues de Melo, R., Zanphorlin, L., Trindade, D.M., Dessen, A. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 8r84 | | Status: | HPUB -- hold until publication | | Title: | pentameric IgMFc-AIM complex focused refinement | | Authors: | Chen, Q., Arai, S., Miyazaki, T., Rosenthal, P. | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8zvr | | Status: | HPUB -- hold until publication | | Title: | Human citrate synthase intermediate 2 | | Authors: | Yang, L.Y., Fang, Y.J. | | Deposition date: | 2024-06-12 |
|
| PDBID: | 9g93 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoET structure of the in vitro grown Bacillus anthracis Sap S-layer | | Authors: | Sogues, A., Leigh, K., Van der Verren, S., Kudryashev, M., Pak, A., Halingstad, E.V., Cecil, A.J., Fioravanti, A., Remaut, H. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 8zvt | | Status: | HPUB -- hold until publication | | Title: | Human citrate synthase intermediate 3 | | Authors: | Yang, L.Y., Fang, Y.J. | | Deposition date: | 2024-06-12 |
|
| PDBID: | 8r83 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | pentameric IgMFc-AIM complex global refinement | | Authors: | Chen, Q., Arai, S., Miyazaki, T., Rosenthal, P. | | Deposition date: | 2023-11-28 |
|
| PDBID: | 9g95 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 8r87 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the Sars-Cov2 S trimer without RBDs | | Authors: | Effantin, G. | | Deposition date: | 2023-11-28 |
|
