| PDBID: | 9fm2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-05 |
|
| PDBID: | 8qeh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-31 | | Release date: | 2024-11-30 |
|
| PDBID: | 8ymz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-10 |
|
| PDBID: | 9fm0 | | Status: | HPUB -- hold until publication | | Title: | Human antibody (Fab) and P. aeruginosa (T3SS) protein PcrV-fragment complex | | Authors: | Desveaux, J.M., Contreras Martel, C., Dessen, A. | | Deposition date: | 2024-06-05 |
|
| PDBID: | 8qht | | Status: | HPUB -- hold until publication | | Title: | Leishmania braziliensis PRMT1-PRMT3 heterotetrameric complex in unliganded form. | | Authors: | Levdikov, V., Nay, E., Walrad, P., Plevin, J.M. | | Deposition date: | 2023-09-10 | | Sequence: | >Entity 1
DYYFDSYSHYGIHMEMLKDYHRTTTYRDAIWRNAYMFKDKVVLDVGCGTGILSMFAARAGARKVIGIDCSNVAVQARQIVQDNGFSDIITIIQGKVEELDLDEKVDIIISEWMGYFLLYESMLNTVLYARDRWGASDVKILPSSANMYACGITDPQYVEQKFNIWNSVNGLDFSYFKRLSYIEPLIDTVNPEQIITDIVPFFSFDINRVTEAELSFTSTFTLEAKQGDFVHAISVHFDTPFYAGHDPVVLNTSPMVPPTHWRQTVLYMFHPLIMKRGEKANFTMKCAPNPGNPRDLDISLHIDFDGELQACHYDQDFRLR
>Entity 2
SAARISSNISTIHDHQRLRAYEVIFRNVRGKTLLHLGCGMGLYSMLAARGMAKMVIGIDSSAIVDAARVVAEQNGLKNIQFIRGRLCEALHQLPSDMKFDYVLCEWMGPLLLNERVLTDALYARDHLLTESGALCPNRASLHVVAVSDYAFRLDTEDFWSNVYGFQMEPMKELVRQEVEMCAIPGSNIVSAPCLAHTIHMDTLEGLTAEETATYEAQANQAAAIRDNEEENPVEHCWVPAAVAQKGYEAAFTLSIARSATVHYLTFYLDAAFTSKTNPGANFVLAVRPGGQNNWTEVSVGLREPLPVNAGEKIQGTVRVYTPAEKGGKVTVVEVTAKTAGQVAAIETFGTYYYQSY
|
|
| PDBID: | 8ymy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-10 |
|
| PDBID: | 9fm5 | | Status: | HPUB -- hold until publication | | Title: | PvSub1 Catalytic Domain in Complex with Peptidomimetic Inhibitor (AL-97) | | Authors: | Batista, F.A., Martinez, M., Bouillon, A., Mechaly, A., Alzari, P.M., Haouz, A., Barale, J.C. | | Deposition date: | 2024-06-05 |
|
| PDBID: | 9fma | | Status: | HOLD -- hold until a certain date | | Title: | Structure of Porphyromonas gingivalis endopeptidase (PgPepO) | | Authors: | Zak, K.M., Grudnik, P., Waligorska, I., Ksiazek, M. | | Deposition date: | 2024-06-05 | | Release date: | 2025-06-05 |
|
| PDBID: | 8qhv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8ymx | | Status: | HPUB -- hold until publication | | Title: | The structure of BRTNaC1 at 40 degree centigrade | | Authors: | Yuan, L., Chen, X., Su, N. | | Deposition date: | 2024-03-10 |
|
| PDBID: | 9flp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-05 |
|
| PDBID: | 8qhw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8yn3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-10 |
|
| PDBID: | 9fls | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-05 |
|
| PDBID: | 8qhx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8yn4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-10 |
|
| PDBID: | 9fli | | Status: | HOLD -- hold until a certain date | | Title: | The structure of GanA, the extracellular galactanase of G.proteiniphilus T-6 | | Authors: | Hadad, N., Lavid, N., Shulami, S., Dessau, M., Shoham, Y., Shoham, G. | | Deposition date: | 2024-06-05 | | Release date: | 2025-06-05 |
|
| PDBID: | 8qhz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8yn5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-10 |
|
| PDBID: | 9flu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-05 |
|
| PDBID: | 8qln | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-20 |
|
| PDBID: | 8yn6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-10 |
|
| PDBID: | 9flv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-05 |
|
| PDBID: | 8yn7 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-10 |
|
| PDBID: | 9fm9 | | Status: | HPUB -- hold until publication | | Title: | Aldehyde dehydrogenase | | Authors: | Lamers, M.H., Schada von Borzyskowski, L., Ren, M. | | Deposition date: | 2024-06-05 |
|
