| PDBID: | 8qrw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-09 |
|
| PDBID: | 9ffj | | Status: | HPUB -- hold until publication | | Title: | Artificial metalloenzyme with a nickel-based 1,10-phenanthroline cofactor and streptavidin N49M-S112V mutant | | Authors: | Lau, K., Wang, W., Pojer, F., Larabi, A. | | Deposition date: | 2024-05-23 |
|
| PDBID: | 8yg1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-26 |
|
| PDBID: | 8qrj | | Status: | HPUB -- hold until publication | | Title: | LCC-ICCG PETase mutant H218Y | | Authors: | Orr, G., Niv, Y., Barakat, M., Boginya, A., Dessau, M., Afriat-Jurnou, L. | | Deposition date: | 2023-10-09 | | Sequence: | >Entity 1
MDGVLWRVRTAALMAALLALAAWALVWASPSVEAQSNPYQRGPNPTRSALTADGPFSVATYTVSRLSVSGFGGGVIYYPTGTSLTFGGIAMSPGYTADASSLAWLGRRLASHGFVVLVINTNSRFDGPDSRASQLSAALNYLRTSSPSAVRARLDANRLAVAGHSMGGGGTLRIAEQNPSLKAAVPLTPWHTDKTFNTSVPVLIVGAEADTVAPVSQYAIPFYQNLPSTTPKVYVELCNASHIAPNSNNAAISVYTISWMKLWVDNDTRYRQFLCNVNDPALCDFRTNNRHCQ
|
|
| PDBID: | 9ffy | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-23 |
|
| PDBID: | 8yga | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-26 |
|
| PDBID: | 8qrz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 9ffz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-23 |
|
| PDBID: | 8yg7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | HSA Copper Indomethacin Complex | | Authors: | Zhang, Z.L., Yang, F. | | Deposition date: | 2024-02-26 | | Release date: | 2025-02-26 |
|
| PDBID: | 8qs5 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 21 (1075354) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 |
|
| PDBID: | 9fg0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-23 |
|
| PDBID: | 8yg8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-26 |
|
| PDBID: | 8qs7 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 70 (1084352) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 |
|
| PDBID: | 9fg1 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-23 |
|
| PDBID: | 8ygo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-26 |
|
| PDBID: | 8qs8 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 78 (1084378) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 |
|
| PDBID: | 9ffv | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-23 |
|
| PDBID: | 8ygc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-26 |
|
| PDBID: | 8qs9 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 83 (1084383) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 |
|
| PDBID: | 9ffe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-23 |
|
| PDBID: | 8ygf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-26 |
|
| PDBID: | 9fgf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-23 |
|
| PDBID: | 8qsa | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 86 (1084384) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8ygn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-26 |
|
| PDBID: | 9fgg | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-23 |
|
