PDBID: | 9fet | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of Human Vaccinia-related kinase 2 (VRK-2) bound to JA-47 | Authors: | Wang, G.Q., Amrhein, J.A., Knapp, S., Structural Genomics Consortium (SGC) | Deposition date: | 2024-05-21 |
|
PDBID: | 8yfc | Status: | AUTH -- processed, waiting for author review and approval | Title: | Human PIEZO1-A1988V-MDFIC | Authors: | Zhang, M.F. | Deposition date: | 2024-02-24 | Release date: | 2025-02-24 |
|
PDBID: | 9ff5 | Status: | HPUB -- hold until publication | Title: | The structure of G.kaustophilus T-1 ScoC-23bp dsDNA complex | Authors: | Hadad, N., Shulami, S., Pomyalov, S., Shoham, Y., Shoham, G. | Deposition date: | 2024-05-22 |
|
PDBID: | 8yff | Status: | AUTH -- processed, waiting for author review and approval | Title: | Human PIEZO1--E756del-MDFIC | Authors: | Zhang, M.F. | Deposition date: | 2024-02-24 | Release date: | 2025-02-24 |
|
PDBID: | 8qp1 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-29 | Release date: | 2025-03-29 |
|
PDBID: | 9ff7 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of the BMOE-crosslinked transcription termination factor Rho in the presence of ppGpp; S84C/M405C double mutant | Authors: | Said, N., Hilal, T., Wahl, M.C. | Deposition date: | 2024-05-22 |
|
PDBID: | 8yfg | Status: | AUTH -- processed, waiting for author review and approval | Title: | Human PIEZO1-R2456H | Authors: | Zhang, M.F. | Deposition date: | 2024-02-24 | Release date: | 2025-02-24 |
|
PDBID: | 8qp2 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-29 | Release date: | 2025-03-29 |
|
PDBID: | 9ff4 | Status: | HPUB -- hold until publication | Title: | The structure of G.kaustophilus T-1 ScoC-17bp dsDNA complex | Authors: | Hadad, N., Shulami, S., Pomyalov, S., Shoham, Y., Shoham, G. | Deposition date: | 2024-05-22 |
|
PDBID: | 8yf6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-24 |
|
PDBID: | 8qp3 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-29 | Release date: | 2025-03-29 |
|
PDBID: | 9ff3 | Status: | HPUB -- hold until publication | Title: | The structure of delta-ScoC, a global regulator protein from Geobacillus kaustophilus T-1 | Authors: | Hadad, N., Shulami, S., Pomyalov, S., Shoham, Y., Shoham, G. | Deposition date: | 2024-05-22 |
|
PDBID: | 8yf7 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-24 |
|
PDBID: | 8qp4 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-29 | Release date: | 2025-03-29 |
|
PDBID: | 9ff6 | Status: | HPUB -- hold until publication | Title: | Human transthyretin (TTR) in complex with (E)-4-((((2-methoxybenzyl)oxy)imino)methyl)benzoic acid (Lic157) | Authors: | Ciccone, L., Shepard, W., Sirigu, S., Camodeca, C., Mazzoccchi, F., Fruchart, C., Nencetti, S., Orlandini, E. | Deposition date: | 2024-05-22 |
|
PDBID: | 8yf8 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-24 |
|
PDBID: | 8qp6 | Status: | HPUB -- hold until publication | Title: | Crystal structure of Hepatitis C Virus E1 glycoprotein epitope 314-324 scaffold design 1W4K_08 in complex with neutralizing antibody F(ab) fragment IGH526 | Authors: | Nagarathinam, K., Krey, T. | Deposition date: | 2023-09-30 | Sequence: | >Entity 1 MGSREVATPHRAAWLAMMLGIDASKVKGTGPGGVITVEDVKRWAEETAKATAGSENLYFQ
>Entity 2 EVQLLEQSGAEVKRPGASVKVSCKASGYTFTSYAIHWVRQAPGQRLEWMGWINPGNGNAKYSQRFQGRVIISRDTSATTSYMELSSLTSEDTAVYSCARDRGFDLLTGHYLGLDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCGSLEDDDDKAGWSHPQFEKGGGSGGGSGGGSWSHPQFEKEIELTLTQPASASATPGQRVTISCSGSSSNIGGNTVNWYQHLPGAAPKLLIHNNDLRPSGVPDRFSGSKSGTSASLAVSGLQSEDEADYFCAAWDDGLNGWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS
|
|
PDBID: | 9ffa | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-22 |
|
PDBID: | 8yf5 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-24 |
|
PDBID: | 8qhb | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-07 |
|
PDBID: | 9ff8 | Status: | HPUB -- hold until publication | Title: | Human transthyretin (TTR) in complex with (E)-2-((((2-chlorobenzyl)oxy)imino)methyl)benzoic acid (Lic166) | Authors: | Ciccone, L., Shepard, W., Sirigu, S., Camodeca, C., Mazzoccchi, F., Fruchart, C., Nencetti, S., Orlandini, E. | Deposition date: | 2024-05-22 |
|
PDBID: | 8yf9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-24 |
|
PDBID: | 9ff9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-22 |
|
PDBID: | 8qpo | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-02 |
|
PDBID: | 8yfe | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-24 |
|