| PDBID: | 9fd3 | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-D190N mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-16 | | Sequence: | >Entity 1
GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIHHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHNIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
| PDBID: | 8xpy | | Status: | HPUB -- hold until publication | | Title: | Structure of Nipah virus Malaysia string G protein ectodomain monomer bound to single-domain antibody n425 at 3.63 Angstroms overall resolution | | Authors: | Sun, L., Chen, Z., Sun, Y., Mao, Q. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8q53 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of truncated human Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) in apo form | | Authors: | Kumar, A., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2023-08-08 |
|
| PDBID: | 9fdc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8xpr | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the human eIF4A1-ATP analog-Rohinitib-polypurine RNA complex | | Authors: | Ito, T., Sakamoto, A. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8q56 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-08 |
|
| PDBID: | 9fdf | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8xq4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8kd0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SAR11_0769 from ''Candidatus Pelagibacter ubique'' HTCC1062 bound to a co-purified ligand, beta-galactopyranose | | Authors: | Clifton, B.E., Laurino, P. | | Deposition date: | 2023-08-08 |
|
| PDBID: | 9fd7 | | Status: | HPUB -- hold until publication | | Title: | Re-engineered peroxygenase variant of 2-deoxy-D-ribose-5-phosphate aldolase in substrate-free state | | Authors: | Thunnissen, A.M.W.H., Zhou, H., Frietema, H.O.T., Poelarends, G.J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8xq5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8kcy | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-08 | | Release date: | 2025-02-08 |
|
| PDBID: | 9fdb | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of Galectin-3 with an inhibitor | | Authors: | Mac Sweeney, A. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8xq6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8kco | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-08 |
|
| PDBID: | 9fe2 | | Status: | HPUB -- hold until publication | | Title: | Crystallographic structure of AcrB V612W with bound minocycline | | Authors: | Lazarova, M., Pos, K.M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 8xq7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8kcr | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of E447A Acyl-CoA Dehydrogenase FadE15 mutant from Mycobacteria tuberculosis in complex with C18CoA | | Authors: | Liu, X., Chen, R., Ma, M. | | Deposition date: | 2023-08-08 |
|
| PDBID: | 9fe3 | | Status: | HPUB -- hold until publication | | Title: | Crystallographic structure of AcrB V612W | | Authors: | Lazarova, M., Pos, K.M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 8xq8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 9fe4 | | Status: | HPUB -- hold until publication | | Title: | Crystallographic structure of AcrB V612F | | Authors: | Lazarova, M., Diederichs, K., Pos, K.M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 8kcp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-08 |
|
| PDBID: | 8xq9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 9fdt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human Sirt2 in complex with a pyrazole-based fragment inhibitor | | Authors: | Friedrich, F., Einsle, O., Jung, M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 8kcs | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human gamma-secretase in complex with BMS906024 | | Authors: | Guo, X., Li, H., Kai, U., Yan, C., Lei, J., Zhou, R., Shi, Y. | | Deposition date: | 2023-08-08 |
|
