| PDBID: | 9fd0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8xpo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 4mrk | | Status: | POLC -- waiting for a policy decision | | Title: | Solution structure of human complement C3b in 137 mM NaCl | | Authors: | Rodriguez, E., Nan, R., Li, K., Gor, J., Perkins, S.J. | | Deposition date: | 2013-09-17 |
|
| PDBID: | 8kcd | | Status: | HPUB -- hold until publication | | Title: | Complex of DDM1-nucleosome(H2A.W) complex with DDM1 bound to SHL2 and SHL-2 | | Authors: | Zhang, H., Zhang, Y. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 9fde | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8xq0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of spleen tyrosine kinase(SYK)in complex with SKI-G-1653 | | Authors: | Bong, S.M., Lee, B.I. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 4mrl | | Status: | POLC -- waiting for a policy decision | | Title: | Solution structure of human complement C3u in 50 mM NaCl | | Authors: | Rodriguez, E., Nan, R., Li, K., Gor, J., Perkins, S.J. | | Deposition date: | 2013-09-17 |
|
| PDBID: | 9fcw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8xq2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of spleen tyrosine kinase(SYK)in complex with SKI-G-1693 | | Authors: | Bong, S.M., Lee, B.I. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8kch | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Sus scrofa complex I close state 2 from supercomplex I+III2+IV in the presence of proguanil | | Authors: | Teng, F., Hu, Y.Q., Zhou, L. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 9fd2 | | Status: | HPUB -- hold until publication | | Title: | Structure of Pol II-TC-NER-STK19 complex | | Authors: | Lee, S.-H., Sixma, T.K. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8xps | | Status: | HPUB -- hold until publication | | Title: | Structure of Nipah virus Bangladesh string G protein ectodomain monomer bound to single-domain antibody n425 at 3.22 Angstroms overall resolution | | Authors: | Sun, L., Chen, Z., Sun, Y., Mao, Q. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8kcg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Sus scrofa complex I close state 3 from supercomplex I+III2+IV in the presence of proguanil | | Authors: | Teng, F., Hu, Y.Q., Zhou, L. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 9fcv | | Status: | HPUB -- hold until publication | | Title: | Cas nuclease-CRISPR (cr)RNA ribonucleoprotein (RNP) complex | | Authors: | Schmelz, S., Lukat, P., Blankenfeldt, W. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8xpu | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8kcj | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -N7 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 9fcx | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-H121N mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-16 | | Sequence: | >Entity 1
GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSINHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHDIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
| PDBID: | 8xpq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8kck | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -N9 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-07 | | Sequence: | >Entity 1
GAEAAAAAAVTAELRAFRAAGGTVELEDLPVTPETLARAEAALARLPPESVAVETYTVPAPTPEAFLAALEAALARLAAEGLPAILLRVVDADGNLVGSILVAAAGPPAESAAATGRVLTIYVASSPEGLKVARGLAIETRDAGGLALAIGASGAWALAGLAGALALARRLAEAHGAPVRVVTIGDPANPTDAALAAAIRAAYAAALEHHHHHH
|
|
| PDBID: | 9f3b | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-25 |
|
| PDBID: | 8xpw | | Status: | HPUB -- hold until publication | | Title: | Marine bacterial laminarinase PtLam treated with 100 mM EDTA | | Authors: | Yang, J. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 9fcy | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-R21K mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-16 | | Sequence: | >Entity 1
GSTYDALKRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIHHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHDIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
| PDBID: | 8q55 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-08 |
|
| PDBID: | 8xq3 | | Status: | HPUB -- hold until publication | | Title: | Structure of Nipah virus Bangladesh string G protein ectodomain tetramer bound to single-domain antibody n425 at 5.87 Angstroms overall resolution | | Authors: | Sun, L., Chen, Z., Sun, Y., Mao, Q. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 9fd3 | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-D190N mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-16 | | Sequence: | >Entity 1
GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIHHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHNIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
