| PDBID: | 8qla | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-19 |
|
| PDBID: | 9fcw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8ydj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | E.coli transcription translation coupling complex in TTC-P containing mRNA with 39-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and viomycin | | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | | Deposition date: | 2024-02-20 | | Release date: | 2025-02-20 |
|
| PDBID: | 8qlb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-19 |
|
| PDBID: | 9fd2 | | Status: | HPUB -- hold until publication | | Title: | Structure of Pol II-TC-NER-STK19 complex | | Authors: | Lee, S.-H., Sixma, T.K. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8ydd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-20 |
|
| PDBID: | 8ql2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-19 |
|
| PDBID: | 9fcv | | Status: | HPUB -- hold until publication | | Title: | Cas nuclease-CRISPR (cr)RNA ribonucleoprotein (RNP) complex | | Authors: | Schmelz, S., Lukat, P., Blankenfeldt, W. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8y2v | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of phospholipase C2 | | Authors: | Zhu, D. | | Deposition date: | 2024-01-27 |
|
| PDBID: | 8qli | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Paradendryphiella salina PL7C alginate lyase mutant H124 soaked with with tetra-mannuronic acid | | Authors: | Wilkens, C. | | Deposition date: | 2023-09-19 |
|
| PDBID: | 9fcx | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-H121N mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-16 | | Sequence: | >Entity 1
GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSINHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHDIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
| PDBID: | 8ydm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of CaRC-LH complex from Chloroflexus aurantiacus | | Authors: | Guoqiang, H., Shishang, D. | | Deposition date: | 2024-02-20 |
|
| PDBID: | 8qlx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-20 |
|
| PDBID: | 9fcy | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-R21K mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-16 | | Sequence: | >Entity 1
GSTYDALKRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIHHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHDIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
| PDBID: | 8ydk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-20 |
|
| PDBID: | 8qlu | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-20 |
|
| PDBID: | 9fd3 | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-D190N mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-16 | | Sequence: | >Entity 1
GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIHHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHNIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
| PDBID: | 8ydl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-20 |
|
| PDBID: | 8qlw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-20 |
|
| PDBID: | 9fdf | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8ydn | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-02-21 | | Release date: | 2025-02-21 |
|
| PDBID: | 9fd7 | | Status: | HPUB -- hold until publication | | Title: | Re-engineered peroxygenase variant of 2-deoxy-D-ribose-5-phosphate aldolase in substrate-free state | | Authors: | Thunnissen, A.M.W.H., Zhou, H., Frietema, H.O.T., Poelarends, G.J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8qly | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Trypanosoma brucei GMP reductase crystallized in cellulo | | Authors: | Boger, J., Redecke, L. | | Deposition date: | 2023-09-20 |
|
| PDBID: | 8ydz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 9fdb | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of Galectin-3 with an inhibitor | | Authors: | Mac Sweeney, A. | | Deposition date: | 2024-05-16 |
|
