| PDBID: | 8zie | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9frm | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of glycogen phosphorylase with an indole derivative | | Authors: | Koulas, S.M., Leonidas, D.D. | | Deposition date: | 2024-06-19 | | Sequence: | >Entity 1
MSRPLSDQEKRKQISVRGLAGVENVTELKKNFNRHLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKI(CSO)GGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQGAKWVDTQVVLAMPYDTPVPGYRNNVVNTMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEEYVK(CSO)QERVSALYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDEKIP
|
|
| PDBID: | 8zig | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9frn | | Status: | HPUB -- hold until publication | | Title: | The RSL-D46H - sulfonato-calix[8]arene complex, acetate pH 4.0 | | Authors: | Flood, R.J., Crowley, P.B. | | Deposition date: | 2024-06-19 |
|
| PDBID: | 8zid | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of free nucleosome asterisk -RFX5 | | Authors: | Xu, K., Zhang, Y., Yin, Y., Xue, W., Han, Y., Tian, Y. | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9frt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of trans-o-hydroxybenzylidenepyruvate hydratase-aldolase from Pseudomonas fluorescens N3 | | Authors: | Milani, M. | | Deposition date: | 2024-06-19 |
|
| PDBID: | 8zjc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharomyces cerevisiae bc1 complex | | Authors: | Ye, Y., Li, Z.W., Yang, G.F. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 9frs | | Status: | HPUB -- hold until publication | | Title: | Human PARP10 ART domain bound to a phthalazinone-based inhibitor | | Authors: | Moche, M., Upadhyaya, K., Cohen, M.S., Schuler, H. | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9frv | | Status: | HPUB -- hold until publication | | Title: | Arginase 2 in complex with inhibitor | | Authors: | Petersen, j. | | Deposition date: | 2024-06-19 |
|
| PDBID: | 8zik | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-14 |
|
| PDBID: | 9fsd | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of complement-inhibiting protein ChiA of Borrelia recurrentis | | Authors: | Fritz-Wolf, K., Rahlfs, S., Przyborski, J.M., Stumpf, M., Roettgerding, F., Kraiczy, P. | | Deposition date: | 2024-06-20 | | Release date: | 2025-06-20 |
|
| PDBID: | 8zij | | Status: | HPUB -- hold until publication | | Title: | The holo structure of gamma-lyase CndF | | Authors: | Gao, Y., Tang, Y., Zhou, J. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8kbn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 9fs2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-20 |
|
| PDBID: | 8ziu | | Status: | HPUB -- hold until publication | | Title: | Mouse MYH6 R404Q left ventricle actin and myosin complex | | Authors: | Li, D.N., Zhao, Q.Y., Liu, C. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8kbo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 9fs3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-20 |
|
| PDBID: | 8zil | | Status: | HPUB -- hold until publication | | Title: | Gamma-lyase CndF in complex with ethyl acetoacetate | | Authors: | Gao, Y., Tang, Y., Zhou, J. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8kbp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 9fs8 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharolobus solfataricus 30S initiation complex bound to Ss-aEF1A-like mRNA | | Authors: | Bourgeois, G., Coureux, P.D., Mechulam, Y., Schmitt, E. | | Deposition date: | 2024-06-20 |
|
| PDBID: | 8ziv | | Status: | HPUB -- hold until publication | | Title: | wtEP-trypsinogen in Tryp-1 | | Authors: | Song, Q.Y., Ding, Z.Y., Huang, H.J. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8kbq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 9fs6 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharolobus solfataricus 30S initiation complex bound to Ss-aIF2beta leaderless mRNA with h44 in up position | | Authors: | Bourgeois, G., Coureux, P.D., Mechulam, Y., Schmitt, E. | | Deposition date: | 2024-06-20 |
|
| PDBID: | 8zj1 | | Status: | HPUB -- hold until publication | | Title: | Human left ventricle F-actin | | Authors: | Li, D.N., Zhao, Q.Y., Liu, C. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8kbr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
