| PDBID: | 8yqo | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of human lanosterol 14alpha-demethylase (CYP51) in complex with FLZ | | Authors: | Zhou, L.C. | | Deposition date: | 2024-03-19 | | Release date: | 2025-03-19 |
|
| PDBID: | 8phh | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Cryo-EM structure of Atkinsonella Hypoxylon Virus-like particles. | | Authors: | Byrne, M.J., Sainsbury, F. | | Deposition date: | 2023-06-19 |
|
| PDBID: | 9fbc | | Status: | HPUB -- hold until publication | | Title: | Dye-decolourising peroxidase DtpB (448 kGy) | | Authors: | Lucic, M., Worrall, J.A.R., Hough, M.A., Strange, R.W., Owen, R.L. | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9fbg | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 Nucleocapsid N-terminal domain (NTD) mutant P151S | | Authors: | Dhamotharan, K., Schlundt, A. | | Deposition date: | 2024-05-13 |
|
| PDBID: | 8yq6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8jse | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-06-19 | | Release date: | 2024-12-19 |
|
| PDBID: | 9fbd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of 3-hydroxybutyryl-CoA dehydrogenase from Thermus thermophilus HB27 complexed to NAD+ | | Authors: | Hurtado-Guerrero, R., Macias-Leon, J., Gines-Alcober, I., Gonzalez-Ramirez, A.M. | | Deposition date: | 2024-05-13 |
|
| PDBID: | 8yq5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8jsa | | Status: | AUCO -- author corrections pending review | | Deposition date: | 2023-06-19 |
|
| PDBID: | 9fbp | | Status: | HPUB -- hold until publication | | Title: | Deletion mutant MmChi60 | | Authors: | Rypniewski, W., Bejger, M., Biniek-Antosiak, K. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8yqg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8phm | | Status: | HPUB -- hold until publication | | Title: | Oxalate-bound cobalt(II) human carbonic anhydrase II | | Authors: | Gigli, L., Malanho Silva, J., Cerofolini, L., Macedo, A.L., Geraldes, C.F.G.C., Suturina, E.A., Calderone, V., Fragai, M., Parigi, G., Ravera, E., Luchinat, C. | | Deposition date: | 2023-06-20 | | Release date: | 2024-12-20 | | Sequence: | >Entity 1
NWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 9fbo | | Status: | HPUB -- hold until publication | | Title: | Deletion mutant of chitinase MmChi60 | | Authors: | Malecki, P.H., Rypniewski, W. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8yql | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8jsq | | Status: | AUCO -- author corrections pending review | | Deposition date: | 2023-06-20 |
|
| PDBID: | 9fbq | | Status: | HPUB -- hold until publication | | Title: | Deletion mutant of chitinase MmChi60 | | Authors: | Malecki, P.H., Rypniewski, W. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8yqd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human transthyretin variant A97S in complex with Tafamidis | | Authors: | Tzeng, S.R., Huang, C.H., Wang, Y.S., Hsieh, M.F. | | Deposition date: | 2024-03-19 |
|
| PDBID: | 9fbr | | Status: | HPUB -- hold until publication | | Title: | Deletion mutant of chitinase MmChi60 | | Authors: | Bejger, M., Rypniewski, W. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8yq3 | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8pik | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-21 | | Release date: | 2024-12-21 |
|
| PDBID: | 9fbs | | Status: | HPUB -- hold until publication | | Title: | Deletion mutant of chitinase MmChi60 | | Authors: | Bejger, M., Rypniewski, W. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8yqm | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | | Deposition date: | 2024-03-19 |
|
| PDBID: | 9fbm | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8yqa | | Status: | HPUB -- hold until publication | | Title: | Galectin-10 L27A | | Authors: | Su, J.Y., Sun, Y.Q. | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8jti | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-21 | | Release date: | 2024-12-21 |
|
