| PDBID: | 9f67 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 |
|
| PDBID: | 8y41 | | Status: | HPUB -- hold until publication | | Title: | VcFadRqm, mutant protein of Fatty Acid Responsive Transcription Factor from Vibrio cholerae, in Complex with oleoyl-CoA | | Authors: | Tsui, W., Shi, W. | | Deposition date: | 2024-01-30 |
|
| PDBID: | 8keu | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-13 | | Release date: | 2024-08-13 |
|
| PDBID: | 9f68 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human Interleukin-31 in complex with Oncostatin-M receptor | | Authors: | Bloch, Y., Savvides, S.N. | | Deposition date: | 2024-04-30 | | Release date: | 2025-04-30 |
|
| PDBID: | 8y44 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-30 |
|
| PDBID: | 8ker | | Status: | HPUB -- hold until publication | | Title: | Structure of SARS-CoV-2 XBB Variant Spike protein complexed with broadly neutralizing antibody PW5-535 | | Authors: | Sun, L., Mao, Q., Wang, Y. | | Deposition date: | 2023-08-13 |
|
| PDBID: | 9f5w | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-30 |
|
| PDBID: | 8y42 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-30 |
|
| PDBID: | 8kep | | Status: | HPUB -- hold until publication | | Title: | The local refined map of SARS-CoV-2 Omicron BA.1 Spike complexed with antibody PW5-570 | | Authors: | Sun, L., Mao, Q., Wang, Y. | | Deposition date: | 2023-08-13 |
|
| PDBID: | 9f5u | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Heme-Oxygenase from Corynebacterium diphtheriae complexed with Cobalt-porphyrine (HumO-Co(III)) | | Authors: | Labidi, R.J., Faivre, B., Carpentier, P., Perard, J., Gotico, P., Li, Y., Atta, M., Fontecave, M. | | Deposition date: | 2024-04-30 |
|
| PDBID: | 8y4n | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Human MRP2 in inward-facing conformation bound with ATPgammaS | | Authors: | Fan, W., Shao, K., Luo, M. | | Deposition date: | 2024-01-30 |
|
| PDBID: | 8keo | | Status: | HPUB -- hold until publication | | Title: | Structure of SARS-CoV-2 Omicron BA.1 Spike complexed with antibody PW5-570 | | Authors: | Sun, L., Mao, Q., Wang, Y. | | Deposition date: | 2023-08-13 |
|
| PDBID: | 9f5v | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thiol peroxidase from Helicobacter pylori (HpTx, reduced) | | Authors: | Fiedler, M.K., Gong, R., Fuchs, S., Rox, K., Friedrich, V., Pfeiffer, D., Reinhardt, T., Mibus, C., Huber, M., Hess, C., Mejias-Luque, R., Gerhard, M., Groll, M., Sieber, S.A. | | Deposition date: | 2024-04-30 | | Sequence: | >Entity 1
MASWSHPQFEKGAVTSLYKKAGFQKVTFKEETYQLEGKALKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSALPSLTGSVCLLQAKHFNEQTGKLPSVSFSVISMDLPFSQGQICGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEALLKVLK
|
|
| PDBID: | 8y4l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-30 |
|
| PDBID: | 8keq | | Status: | HPUB -- hold until publication | | Title: | State 1 of SARS-CoV-2 XBB Variant Spike protein trimer complexed with antibody PW5-5 | | Authors: | Sun, L., Mao, Q., Wang, Y. | | Deposition date: | 2023-08-13 |
|
| PDBID: | 9f64 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thiol peroxidase mutant (C94A) in complex with Metro* (H. pylori | | Authors: | Fiedler, M.K., Gong, R., Fuchs, S., Rox, K., Friedrich, V., Pfeiffer, D., Reinhardt, T., Mibus, C., Huber, M., Hess, C., Mejias-Luque, R., Gerhard, M., Groll, M., Sieber, S.A. | | Deposition date: | 2024-04-30 | | Sequence: | >Entity 1
MASWSHPQFEKGAVTSLYKKAGFQKVTFKEETYQLEGKALKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSALPSLTGSVCLLQAKHFNEQTGKLPSVSFSVISMDLPFSQGQIAGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEALLKVLK
|
|
| PDBID: | 8y4k | | Status: | HPUB -- hold until publication | | Title: | Metal Beta-Lactamase VIM-2 in Complex with MBL inhibitor B17 | | Authors: | Li, G.-B., Wang, S.-Y. | | Deposition date: | 2024-01-30 |
|
| PDBID: | 8ket | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human complex A | | Authors: | Qian, H.W., He, J.J. | | Deposition date: | 2023-08-13 | | Release date: | 2025-02-13 |
|
| PDBID: | 9f65 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thiol peroxidase mutant (C94A) in complex with Metro-P3* (H. pylori) | | Authors: | Fiedler, M.K., Gong, R., Fuchs, S., Rox, K., Friedrich, V., Pfeiffer, D., Reinhardt, T., Mibus, C., Huber, M., Hess, C., Mejias-Luque, R., Gerhard, M., Groll, M., Sieber, S.A. | | Deposition date: | 2024-04-30 | | Sequence: | >Entity 1
MASWSHPQFEKGAVTSLYKKAGFQKVTFKEETYQLEGKALKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSALPSLTGSVCLLQAKHFNEQTGKLPSVSFSVISMDLPFSQGQIAGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEALLKVLK
|
|
| PDBID: | 8y4o | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Human MRP2 in occluded conformation bound with ATPgammaS | | Authors: | Fan, W., Shao, K., Luo, M. | | Deposition date: | 2024-01-30 |
|
| PDBID: | 8kes | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-13 | | Release date: | 2025-02-13 |
|
| PDBID: | 9f66 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Heme-Oxygenase from Corynebacterium diphtheriae complexed with Cobalt-porphyrine (HumO-Co(III)) flash-cooled under CO2 pressure | | Authors: | Labidi, R.J., Faivre, B., Carpentier, P., Perard, J., Gotico, P., Li, Y., Atta, M., Fontecave, M. | | Deposition date: | 2024-04-30 |
|
| PDBID: | 4j8h | | Status: | POLC -- waiting for a policy decision | | Title: | Solution Structure of Heparin dp18 | | Authors: | Khan, S., Gor, J., Mulloy, B., Perkins, S.J. | | Deposition date: | 2013-02-14 | | Release date: | 2020-02-14 |
|
| PDBID: | 8y4p | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Human MRP2 in inward-facing conformation bound with Methotrexate and ATPgammaS | | Authors: | Fan, W., Shao, K., Luo, M. | | Deposition date: | 2024-01-30 |
|
| PDBID: | 9f69 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 | | Sequence: | >Entity 1
RKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIINAKQ
|
|
