| PDBID: | 8z7a | | Status: | HOLD -- hold until a certain date | | Title: | Open Barrel Structure of Translin from Trichoderma virens | | Authors: | Kumari, S., Gupta, G.D. | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMAAPPPALLDPSIFASLEAKLEEETQIRDTLSQLIQRLDRAVATAQGLLSRVHSTPRSRYPQLVSQVEAAVKEEAAIISELDTVASKHPYYKYNQRWTRSMQHAIGTAIYCAWLGGFPSQSSESEASSPAEIGRLLTLEEVGTIFSVPTNLKDRDAFHITIEEYLLSLVDLTQDLSRLATNSVTLGDFQLPLTISAFVKDLFAGFQLLNLKNDIIRKRADSVKYEVKRVEDIVYDLSLRGLIQRPGAGDTEMEAAE
|
|
| PDBID: | 9fc3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8z6e | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 |
|
| PDBID: | 9fe1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-17 |
|
| PDBID: | 8z6d | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 |
|
| PDBID: | 9fdo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-17 |
|
| PDBID: | 8z6w | | Status: | HPUB -- hold until publication | | Title: | Structure of EG.5.1 S trimer with 3 down-RBDs complex with antibody CYFN1006-2. | | Authors: | Wang, Y.J., Sun, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9f7o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-04 |
|
| PDBID: | 8z6y | | Status: | HPUB -- hold until publication | | Title: | Medium-chain dehydrogenase/reductase MrADH mutant-V164K&V221A&H333K | | Authors: | Xue, J.Y., Xu, G.C., Ni, Y. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8p6p | | Status: | HPUB -- hold until publication | | Title: | Mycoplasma pneumoniae small ribosomal subunit in chloramphenicol-treated cells | | Authors: | Schacherl, M., Xue, L., Spahn, C.M.T., Mahamid, J. | | Deposition date: | 2023-05-27 | | Release date: | 2024-11-27 |
|
| PDBID: | 9ffy | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-23 |
|
| PDBID: | 8z6i | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9ffz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-23 |
|
| PDBID: | 8z6q | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 XBB.1.16 Spike in complex with CYFN1006-1(S-CYFN1006-1 dimer trimer). | | Authors: | Wang, Y.J., Sun, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8p6t | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Fucosidase Crystal straucture | | Authors: | Gallego del Sol, F., Marina, A. | | Deposition date: | 2023-05-29 | | Release date: | 2024-11-29 |
|
| PDBID: | 9fhi | | Status: | HPUB -- hold until publication | | Title: | Phage 7-7-1 capsid pentamer hexamers | | Authors: | Ouyang, R. | | Deposition date: | 2024-05-27 |
|
| PDBID: | 8z6h | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9fb6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-12 |
|
| PDBID: | 8z6f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9flp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-05 |
|
| PDBID: | 8z6u | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 EG.5.1 Spike in complex with CYFN1006-2(S-CYFN1006-2 dimer trimer). | | Authors: | Wang, Y.J., Sun, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9exk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-08 |
|
| PDBID: | 8z6j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9few | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-21 |
|
| PDBID: | 8z6c | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HDGFRP2 PWWP domain in complex with 4-(4-bromo-1H-pyrazol-3-yl) pyridine | | Authors: | Wei, X., Ruan, K. | | Deposition date: | 2024-04-19 |
|
