| PDBID: | 7gwj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9bdk | | Status: | HPUB -- hold until publication | | Title: | CP20.2 Fab in complex with HIV-1 Env BG505 SOSIP.664 and RM20A3 Fab | | Authors: | Ozorowski, G., Lee, W.-H., Ward, A.B. | | Deposition date: | 2024-04-12 |
|
| PDBID: | 8vcs | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the oligomeric rMcL-1 in complex with lactose | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 | | Sequence: | >Entity 1
GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
| PDBID: | 7gwk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9bdy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | AT-centric NF-kappaB RelA binding DNA | | Authors: | Biswas, T., Shahabi, S., Tsodikov, O.V., Ghosh, G. | | Deposition date: | 2024-04-13 |
|
| PDBID: | 8vcq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the oligomeric rMcL-1 in complex with raffinose | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 |
|
| PDBID: | 7gwl | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9bdz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | TA-centric NF-kappaB RelA binding DNA | | Authors: | Biswas, T., Shahabi, S., Tsodikov, O.V., Wang, V., Ghosh, G. | | Deposition date: | 2024-04-13 |
|
| PDBID: | 8vcu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the oligomeric rMcL-1 in complex with lactulose | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 |
|
| PDBID: | 7gwm | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9be0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | GC-centric NF-kappaB RelA binding DNA | | Authors: | Biswas, T., Shahabi, S., Tsodikov, O.V., Ghosh, G. | | Deposition date: | 2024-04-13 |
|
| PDBID: | 8vck | | Status: | HPUB -- hold until publication | | Title: | Galactose-binding lectin from Mytilus californianus, Isoform 1 (rMcL-1) | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 | | Sequence: | >Entity 1
GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
| PDBID: | 7gwn | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9be1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CG-centric NF-kappaB RelA binding DNA | | Authors: | Biswas, T., Shahabi, S., Tsodikov, O.V., Wang, V., Ghosh, G. | | Deposition date: | 2024-04-13 |
|
| PDBID: | 8vd2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-14 |
|
| PDBID: | 7gwp | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9be3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-13 |
|
| PDBID: | 8vd0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-14 |
|
| PDBID: | 7gwq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9be4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-13 |
|
| PDBID: | 8vcg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-14 |
|
| PDBID: | 7gwr | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9b4v | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-21 | | Release date: | 2025-03-21 |
|
| PDBID: | 8vcf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-14 |
|
| PDBID: | 7gws | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
