| PDBID: | 8w7e | | Status: | HPUB -- hold until publication | | Title: | Design, synthesis and biological evaluations of novel small molecular hyper-activators of human caseinolytic peptidase P (hClpP) | | Authors: | Jiang, J.-X., Ding, H., Chen, M.-R., Lu, M.-L., Sun, H.-Y., Xiao, Y.-B. | | Deposition date: | 2023-08-30 |
|
| PDBID: | 8zwt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of atypical two cysteine thiol peroxidase from Staphylococcus aureus | | Authors: | Shukla, M., Maji, S., Yadav, V.K., Bhattacharyya, S. | | Deposition date: | 2024-06-13 |
|
| PDBID: | 8w70 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-30 | | Release date: | 2024-08-30 |
|
| PDBID: | 8zwq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-13 |
|
| PDBID: | 8zwn | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of DNA-binding transcriptional activator EvgA from Escherichia coli str. K-12 substr. MG1655 | | Authors: | Teng, Y., Liu, R., Luo, B. | | Deposition date: | 2024-06-13 |
|
| PDBID: | 8w7x | | Status: | HPUB -- hold until publication | | Title: | SPS_Carbonic Anhydrases | | Authors: | Chun, I.S., Kim, M.S. | | Deposition date: | 2023-08-31 |
|
| PDBID: | 8zyb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-17 | | Release date: | 2025-06-17 |
|
| PDBID: | 8zyc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-17 |
|
| PDBID: | 3tko | | Status: | POLC -- waiting for a policy decision | | Title: | Solution structure of a complement therapeutic reagent TT30 | | Authors: | Perkins, S.J., Li, K., Gor, J., Holers, V.M., Storek, M.J. | | Deposition date: | 2011-08-28 |
|
| PDBID: | 8w82 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-31 |
|
| PDBID: | 8zys | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of HSF5 DNA-binding domain in complex with 3-site HSE DNA (25 bp) | | Authors: | Shi, X., Zhang, Q., Liu, W. | | Deposition date: | 2024-06-18 |
|
| PDBID: | 8w7r | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | H. walsbyi bacteriorhodopsin mutant - W94F | | Authors: | Li, G.Y., Chen, J.C., Yang, C.S. | | Deposition date: | 2023-08-31 | | Release date: | 2024-08-31 |
|
| PDBID: | 9bl4 | | Status: | HPUB -- hold until publication | | Title: | KIR3DL1*086 in complex with HLA-B*57:03 presenting the AW10 peptide | | Authors: | Faoro, C., Rossjohn, J. | | Deposition date: | 2024-04-29 |
|
| PDBID: | 9bl6 | | Status: | HPUB -- hold until publication | | Title: | KIR3DL1*114 in complex with HLA-A*24:02 presenting the TW9 peptide | | Authors: | Faoro, C., Rossjohn, J. | | Deposition date: | 2024-04-29 |
|
| PDBID: | 8w7y | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of GcCGT in complex with UDP | | Authors: | Zhang, M., Bao, Y. | | Deposition date: | 2023-08-31 | | Release date: | 2024-08-31 |
|
| PDBID: | 9bl9 | | Status: | HPUB -- hold until publication | | Title: | KIR3DL1*114 in complex with HLA-A*24:02 presenting the NEF peptide | | Authors: | Faoro, C., Rossjohn, J. | | Deposition date: | 2024-04-29 |
|
| PDBID: | 9ba1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8w8i | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-02 | | Sequence: | >Entity 1
MKKLLIAAGSVKSSSRTPSDKPVAHVVANPEAEGQLQWLSRRANALLANGVELTDNQLIVPSDGLYLIYSQVLFKGQGCPSTHVLLTHTISRFAVSYQTKVNLLSAIKSPCQRETPEGTEAKPWYEPIYLGGVFQLEKGDRLSAEINLPNYLDFAESGQVYFGIIALHHHHHH
>Entity 2
MKKLLIAAGSEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYWMYWVRQAPGKGLEWVSKINTNGLITKYPDSVKGRFTISRDNAKNTLYLQMNSLRPEDTAVYYCARSPSGFNRGQGTLVTVSSHHHHHH
|
|
| PDBID: | 9b9p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 | | Sequence: | >Entity 1
MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDNGYDVVIGIRPGRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNEIEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGIQQDASGQARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVSKLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRYSISNTAEFGDYVSGPRVITPDVKENMKAVLTDIQNGNFSNRFIEDNKNGFKEFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEKHHHHHH
|
|
| PDBID: | 8w8g | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human TRF1 with PinX1 | | Authors: | Lei, M., Wu, J. | | Deposition date: | 2023-09-02 |
|
| PDBID: | 9b9q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8w8h | | Status: | HPUB -- hold until publication | | Title: | 2-Ketoglutarate-Dependent Dioxygenase | | Authors: | Zheng, C.N., Wei, W.Q. | | Deposition date: | 2023-09-02 |
|
| PDBID: | 9b9x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8w8j | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of bacterial prolyl-tRNA synthetase in complex with inhibitor PAA-19 | | Authors: | Luo, Z., Zhou, H. | | Deposition date: | 2023-09-03 |
|
| PDBID: | 9b9t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the ternary complex of DCAF1 and WDR5 with PROTAC, OICR-40407 | | Authors: | Mabanglo, M.F., Hoffer, L., Al-awar, R., Vedadi, M. | | Deposition date: | 2024-04-03 |
|
