| PDBID: | 8uca | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-26 |
|
| PDBID: | 9au6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8ucj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-26 |
|
| PDBID: | 9au3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8uck | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-26 |
|
| PDBID: | 9au5 | | Status: | HPUB -- hold until publication | | Title: | Ternary complex of human DNA polymerase theta polymerase domain with a cognate G:C base pair | | Authors: | Li, C., Gao, Y. | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8ucl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-26 |
|
| PDBID: | 9au4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8ucm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-26 |
|
| PDBID: | 9au8 | | Status: | HPUB -- hold until publication | | Title: | Ternary complex of human DNA polymerase theta polymerase domain with a mismatched T:T base pair | | Authors: | Li, C., Gao, Y. | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8ucn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-26 |
|
| PDBID: | 9au7 | | Status: | HPUB -- hold until publication | | Title: | Human Retriever VPS35L/VPS29/VPS26C complex bound to SNX17 peptide (Composite Map) | | Authors: | Chen, B., Chen, Z., Han, Y., Boesch, D.J., Juneja, P., Burstein, E., Fung, H.Y.J. | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8uco | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-26 |
|
| PDBID: | 9au9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8ucp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-26 |
|
| PDBID: | 9auq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of 4-Fluoro-tryptophan labeled Oscillatoria Agardhii agglutinin | | Authors: | Runge, B.R., Zadorozhnyi, R.R., Quinn, C.M., Russell, R.W., Lu, M., Antolinez, S., Struppe, J., Schwieters, C.D., Byeon, I.L., Hadden-Perilla, J., Gronenborn, A.M., Polenova, T. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8udi | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of Helicobacter pylori glutamate racemase bound to D-glutamate and a crystallographic artifact | | Authors: | Propp, J., Spies, M.A. | | Deposition date: | 2023-09-28 | | Release date: | 2024-09-28 |
|
| PDBID: | 9aur | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8udb | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Mu class GST from TuGSTm12 (Tetur05g05300) from Tetranychus urticae | | Authors: | Khatri, K., Arriaza, R., Chruszcz, M. | | Deposition date: | 2023-09-28 |
|
| PDBID: | 9aus | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8udd | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Mu class Glutathione-S-Transferase, TuGSTm12(Tetur05g05300) from Tetranychus urticae | | Authors: | Khatri, K., Arriaza, R.H., Chruszcz, M. | | Deposition date: | 2023-09-28 |
|
| PDBID: | 9aud | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8ude | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Mu class Glutathione-S-Transferase, TuGSTm06(Tetur05g05220) from Tetranychus urticae | | Authors: | Khatri, K., Arriaza, R.H., Chruszcz, M. | | Deposition date: | 2023-09-28 |
|
| PDBID: | 9aut | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8udf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 3CL protease with inhibitor DEL_7 | | Authors: | Forouhar, F., Liu, H., Zack, A., Iketani, S., Williams, A., Vaz, D.R., Habashi, D.L., Resnick, S.J., Chavez, A., Ho, D.D., Stockwell, B.R. | | Deposition date: | 2023-09-28 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGS(CSO)GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
