| PDBID: | 9bfo | | Status: | HOLD -- hold until a certain date | | Title: | BCAT mutant 36E | | Authors: | Dong, M., Dare, E. | | Deposition date: | 2024-04-18 | | Release date: | 2025-04-18 |
|
| PDBID: | 8uyv | | Status: | HPUB -- hold until publication | | Title: | HBV T=4 3A mutant capsid from HEK-293T cells | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRAPRRRTPAPRRRRSQAPRRRRSQSREPQC
|
|
| PDBID: | 7g68 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 9bg8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8uyw | | Status: | HPUB -- hold until publication | | Title: | HBV T=3 3A mutant capsid from HEK-293T cells | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRAPRRRTPAPRRRRSQAPRRRRSQSREPQC
|
|
| PDBID: | 7g69 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 9bfk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8uyx | | Status: | HPUB -- hold until publication | | Title: | HBV Cp149 capsid protein (Wild-type control) | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTL
|
|
| PDBID: | 7g6b | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 9bgf | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8uyy | | Status: | HPUB -- hold until publication | | Title: | HBV Cp149 capsid protein (Preassembled capsid incubated with triton X-100) | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
|
|
| PDBID: | 7g6c | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 9bgh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KRAS G12D in a transition state mimetic complex with CypA and RMC-7977 | | Authors: | Pourfarjam, Y., Goldgur, Y., Cuevas-Navarro, A., Lito, P. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8uyz | | Status: | HPUB -- hold until publication | | Title: | HBV Cp149 capsid protein (HBV dimer co-assembled with triton X-100) | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
|
|
| PDBID: | 7g6d | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 9bgy | | Status: | HPUB -- hold until publication | | Title: | Ancestral uncoupled aspartate transporter, apo conditions, low-affinity state | | Authors: | Reddy, K.D., Boudker, O. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8uzc | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Structure of UT14 Fab in complex with the head domain of H3 (A/Singapore/INFIMH-16-0019/2016) | | Authors: | Park, J., Georgiou, G. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 7g6e | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 9bgm | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8uz3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-14 |
|
| PDBID: | 7g6f | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 9bgn | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8uyr | | Status: | HPUB -- hold until publication | | Title: | Manganese-substituted DitZ from Rhodococcus Rhodochrous | | Authors: | Liu, C., Chen, S., Rittle, J. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 7g6n | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 9bgo | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-19 |
|
