| PDBID: | 8zph | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-30 |
|
| PDBID: | 7g2u | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8s73 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8zpk | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of origin recognition complex (Orc6 with residues 1 to 270 deleted) with ARS1 DNA bound | | Authors: | Lam, W.H., Yu, D., Dang, S., Zhai, Y. | | Deposition date: | 2024-05-30 | | Release date: | 2025-05-30 |
|
| PDBID: | 7g2v | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8s77 | | Status: | HPUB -- hold until publication | | Title: | Soluble epoxide hydrolase in complex with PROTAC JSF234 | | Authors: | Kumar, A., Schoenfeld, J., Hiesinger, K., Lillich, F., Proschak, E., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-02-29 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMASMLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARNPPVVSKMLLEHHHHHH
|
|
| PDBID: | 8zpo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-30 |
|
| PDBID: | 7g2w | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8s7j | | Status: | HPUB -- hold until publication | | Title: | Coxsackievirus A9 bound with compound 20 (CL300) | | Authors: | Plavec, Z., Butcher, S.J., Mitchell, C., Buckner, C. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8zpj | | Status: | HOLD -- hold until a certain date | | Title: | EcGK bundle at APO state. (CASP target) | | Authors: | Zhang, T., Leng, Q., Liu, L.J. | | Deposition date: | 2024-05-30 | | Release date: | 2024-07-25 | | Sequence: | >Entity 1
MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHLGYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDTLRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQKGLYTADPRSNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIAAGSKPGVIGDVMEGISVGTLFHAQATPLENRKRWIFGAPPAGEITVDEGATAAILERGSSLLPKGIKSVTGNFSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAGHHSQEIDAILGYEYGPVAVHRDDMITR
|
|
| PDBID: | 7g2x | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8s7h | | Status: | HPUB -- hold until publication | | Title: | Fructose 6-phosphate aldolase (FSA) from Escherichia coli | | Authors: | Hebert, H., Widersten, M. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8zpl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-30 |
|
| PDBID: | 7g2y | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8s7i | | Status: | HPUB -- hold until publication | | Title: | Fructose 6-phosphate aldolase, L107C/A129G/R134V/L163C/S166G mutant | | Authors: | Hebert, H., Widersten, M. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8zpm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-30 |
|
| PDBID: | 7g2z | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8s7k | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8zpn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-30 |
|
| PDBID: | 7g30 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8s7f | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Escherichia coli LpxH in complex with EBL-2805 | | Authors: | Sooriyaarachchi, S., Mowbray, S.L., Bergfors, T., Jones, T.A. | | Deposition date: | 2024-03-01 | | Sequence: | >Entity 1
MATLFIADLHLCAEEPAITAGFLRFLAGEARKADALYILGDLFEAWIGDDDPNPLHHQMAAAIKAVSDSGVPCYFIHGNRDFLLGKRFARESGMTLLPEEKVLELYGRRVLIMHGDTLCTDDAGYQAFRAKVHKPWLQTLFLALPLFVRKRIAARMRANSKEANSSKSLAIMDVNQNAVVSAMEKHQVQWLIHGHTHRPAVHELIANQQTAFRVVLGAWHTEGSMVKVTADDVELIHFPFHHHHHH
|
|
| PDBID: | 8zpd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of pre-pore conformation of S. aureus Alpha-hemolysin derived from 10:0 PC liposomes | | Authors: | Dutta, S., Chatterjee, A., Roy, A. | | Deposition date: | 2024-05-30 |
|
| PDBID: | 8s7g | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Pseudomonas aeruginosa Recombinase A (RecA) in complex with LexAS125A mutant | | Authors: | De Felice, S., Vascon, F., Huber, S.T., Catalano, C., Jakobi, A.J., Cendron, L. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8zpi | | Status: | HOLD -- hold until a certain date | | Title: | The cryoEM structure of a daminobutyrate--2-oxoglutarate transaminase EctB | | Authors: | Jiang, W.X., Cheng, X.Q., Ma, L.X., Xing, Q. | | Deposition date: | 2024-05-30 | | Release date: | 2025-05-30 |
|
| PDBID: | 8s7l | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a double mutant of VirB8-like OrfG central and C-terminal domains of Streptococcus thermophilus ICESt3 (Gram positive conjugative type IV secretion system). | | Authors: | Favier, F., Didierjean, C., Maffo-Woulefack, R., Douzi, B., Leblond-Bourget, N. | | Deposition date: | 2024-03-03 |
|
