PDBID: | 8zeq | Status: | HPUB -- hold until publication | Title: | Structural insights into human glycogen debranching enzyme (GDE) | Authors: | Guan, H., Chen, H. | Deposition date: | 2024-05-06 |
|
PDBID: | 8u5i | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of human IDO1 bound to Compound 23 | Authors: | Steinbacher, S., Lammens, A., Harris, S.F. | Deposition date: | 2023-09-12 |
|
PDBID: | 8zen | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM structure of Adr-2-Adbp-1-dsRBD0 complex | Authors: | Liu, Z.M., Mu, J.Q., Wu, C. | Deposition date: | 2024-05-06 | Release date: | 2025-05-06 |
|
PDBID: | 8u5o | Status: | HPUB -- hold until publication | Title: | The structure of the catalytic domain of NanI sialdase in complex with Neu5Gc | Authors: | Medley, B.J., Low, K.E., Garber, J.M., Gray, T.E., Liu, L., Klassen, L., Fordwour, O.B., Inglis, G.D., Boons, G.J., Zandberg, W.F., Abbott, W.D., Boraston, A.B. | Deposition date: | 2023-09-12 |
|
PDBID: | 8zem | Status: | HOLD -- hold until a certain date | Title: | Crystal Structure of NLRP3 NACHT domain in complex with NP3-1 | Authors: | Shi, C., Liu, Z.M. | Deposition date: | 2024-05-06 | Release date: | 2025-05-06 |
|
PDBID: | 8u59 | Status: | HPUB -- hold until publication | Title: | EcDsbA soaked with N-(2-fluorophenyl)-5-methylisoxazole-3-carboxamide and N-(4-(thiophen-3-yl)benzyl)cyclohexanamine | Authors: | Wang, G., Heras, B. | Deposition date: | 2023-09-12 | Sequence: | >Entity 1 AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
PDBID: | 8zeo | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Adr-2-Adbp-1-dsRBD1 complex | Authors: | Liu, Z.M., Mu, J.Q., Wu, C. | Deposition date: | 2024-05-06 |
|
PDBID: | 8u57 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-12 |
|
PDBID: | 8zep | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Adr-2-Adbp-1-dsRBD2 complex | Authors: | Liu, Z.M., Mu, J.Q., Wu, C. | Deposition date: | 2024-05-06 |
|
PDBID: | 8u56 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-09-12 |
|
PDBID: | 8zfh | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-05-07 | Release date: | 2025-05-07 |
|
PDBID: | 8t2q | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-06 | Release date: | 2024-12-04 |
|
PDBID: | 8zfj | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-07 |
|
PDBID: | 8u58 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-12 |
|
PDBID: | 8zew | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-07 |
|
PDBID: | 8u5c | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-09-12 |
|
PDBID: | 8zf2 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-07 |
|
PDBID: | 8u5n | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-12 |
|
PDBID: | 8zf3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-07 |
|
PDBID: | 8u62 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of PsBphP in Pfr state, Dimer of Dimers FL | Authors: | Basore, K., Burgie, E.S., Vierstra, D. | Deposition date: | 2023-09-13 |
|
PDBID: | 8zf6 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of the xGPR4-Gs complex in pH6.7 | Authors: | Rong, N.K., Wen, X., Yang, F., Sun, J.P. | Deposition date: | 2024-05-07 |
|
PDBID: | 8u63 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of PsBphP in Pfr state, Dimer of Dimers PSM only | Authors: | Basore, K., Burgie, E.S., Vierstra, D. | Deposition date: | 2023-09-13 |
|
PDBID: | 8zfa | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of the xtGPR4-Gs complex in pH7.2 | Authors: | Rong, N.K., Wen, X., Yang, F., Sun, J.P. | Deposition date: | 2024-05-07 |
|
PDBID: | 8u64 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of PsBphP in Pfr state, medial PSM only | Authors: | Basore, K., Burgie, E.S., Vierstra, D. | Deposition date: | 2023-09-13 |
|
PDBID: | 8zf7 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of the receptor of xGPR4-Gs complex in pH6.7 | Authors: | Rong, N.K., Wen, X., Yang, F., Sun, J.P. | Deposition date: | 2024-05-07 |
|