| PDBID: | 8u2f | | Status: | HPUB -- hold until publication | | Title: | Vibrio parahaemolyticus ToxS periplasmic domain | | Authors: | Kim, M., Kull, F.J., Midgett, C.R. | | Deposition date: | 2023-09-06 | | Sequence: | >Entity 1
MSDLKVEQVLTSNEWQSTMVTVITDNLPDDTVGPLRRVNVESNVKYLPNGDYIRVSNIKLFAQGSTAESTINISEKGRWEVSDNYLLVSPSEFKDISSSQSKDFSEAQLRLITQIFKLDAEQSRRIDVVNEKTLLLTSLNHGSTVLFRN
|
|
| PDBID: | 8zde | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HsmR with DNA bound | | Authors: | Park, S.Y. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8u2n | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The cryo-EM structure of Pseudomonas phage vB_PaeM_C2-10_Ab1 neck (portal:H-t-T:collar:gateway) | | Authors: | Li, F., Cingolani, G. | | Deposition date: | 2023-09-06 | | Release date: | 2025-03-12 |
|
| PDBID: | 8zdf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the integrin avb3 with CWHM-12, conformation 2 | | Authors: | Xi, Z. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8u2h | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human LC3A soaked with RAHQ-C [Ru(p-cymene)(N,O-8-hydroxyquinlinato)Cl] | | Authors: | Eade, L., Sullivan, M.P., Hartinger, C.G., Goldstone, D.C. | | Deposition date: | 2023-09-06 |
|
| PDBID: | 8zdg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the integrin avb3 with CWHM-12, conformation 1 | | Authors: | Xi, Z. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8u2g | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human LC3A soaked with RAPTA-C | | Authors: | Eade, L., Sullivan, M.P., Hartinger, C.G., Goldstone, D.C. | | Deposition date: | 2023-09-06 |
|
| PDBID: | 8zdz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8u2j | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human GABARAPL2 soaked with RAHQ-C [Ru(p-cymene)(N,O-8-hydroxyquinolato)Cl] | | Authors: | Eade, L., Sullivan, M.P., Hartinger, C.G., Goldstone, D.C. | | Deposition date: | 2023-09-06 |
|
| PDBID: | 8zds | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8u2i | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of human GABARAPL2 soaked with RAPTA-C | | Authors: | Eade, L., Sullivan, M.P., Hartinger, C.G., Goldstone, D.C. | | Deposition date: | 2023-09-06 |
|
| PDBID: | 8zdw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8u2k | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of human GABARAPL1 soaked with RAPTA-C | | Authors: | Eade, L., Sullivan, M.P., Hartinger, C.G., Goldstone, D.C. | | Deposition date: | 2023-09-06 |
|
| PDBID: | 8zdt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8zdu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8u39 | | Status: | HPUB -- hold until publication | | Title: | Structure of Human Mitochondrial Chaperonin V72I mutant | | Authors: | Chen, L., Wang, J. | | Deposition date: | 2023-09-07 | | Sequence: | >Entity 1
AKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLIQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKEIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSIQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGEVIVTKDDAMLLKGKGDKAQIEKRIQEIIEQLDVTTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPALDSLTPANEDQKIGIEIIKRTLKIPAMTIAKNAGVEGSLIVEKIMQSSSEVGYDAMAGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLTTAEVVVTEIP
|
|
| PDBID: | 8zdx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MjHKU4r-CoV-1 RBD bound to hDPP4 | | Authors: | Yang, M., Li, Z., Xu, Y., Zhang, S. | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8u38 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-07 |
|
| PDBID: | 8zdr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8u3o | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 Main Protease A173V in complex with CDD-1819 | | Authors: | Nnabuife, C., Palzkill, T. | | Deposition date: | 2023-09-08 |
|
| PDBID: | 8zdv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8u41 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-08 |
|
| PDBID: | 8zdy | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8u42 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-08 |
|
| PDBID: | 8ze4 | | Status: | HPUB -- hold until publication | | Title: | MPXV mRNA cap N7 methyltransferase mutant-H122D | | Authors: | Chen, A.k., Li, J.X. | | Deposition date: | 2024-05-04 |
|
