| PDBID: | 9fnc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-10 |
|
| PDBID: | 8rly | | Status: | HPUB -- hold until publication | | Title: | E. coli endonuclease IV complexed with sulfate, catalytic Fe2+ | | Authors: | Saper, M.A., Paterson, N.G., Kirillov, S., Rouvinski, A. | | Deposition date: | 2024-01-04 | | Sequence: | >Entity 1
MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTIDEFKAACEKYHYTSAQILPHDSYLINLGHPVTEALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAGQGSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEKTFADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQDDRFDGIPLILETINPDIWAEEIAWLKAQQTEKAVA
|
|
| PDBID: | 9fng | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-10 |
|
| PDBID: | 8ys8 | | Status: | HPUB -- hold until publication | | Title: | The Cyro-EM Structure of human SLC26A3 with non-specific inhibitor Tenidap | | Authors: | Feng, J.R., Dang, S. | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8rm1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 9fnh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-10 |
|
| PDBID: | 8rlz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8ys7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of actinomycin D and Echinomycin-d(ACGGGCT/AGCCCCGT) complex | | Authors: | Lee, Y.Y., Hou, M.H. | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9fnq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Aerolysin double mutant K238A/K244A in styrene-maleic acid lipid particles | | Authors: | Anton, J.S., Bada Juarez, J.F., Marcaida, M.J., Dal Peraro, M. | | Deposition date: | 2024-06-10 |
|
| PDBID: | 8rlw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
| PDBID: | 9fno | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-10 |
|
| PDBID: | 8ys1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of rat thioredoxin, Wild-type | | Authors: | Baba, T., Ueno, G., Ohe, C., Saji, S., Yamamoto, S., Yamamoto, M., Ouchida, M., Kawasaki-Ohmori, I., Takeshita, K. | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8rm3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ferrioxamine transporter FoxA | | Authors: | Josts, I., Tidow, H., Mislin, G. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8ys0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9fnm | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-06-10 |
|
| PDBID: | 8rlx | | Status: | HPUB -- hold until publication | | Title: | Erk2 MAP kinase T188A mutant | | Authors: | Livnah, O., Gutman, D. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 9fnp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Aerolysin double mutant K238A/K244A in styrene-maleic acid lipid particles | | Authors: | Anton, J.S., Bada Juarez, J.F., Marcaida, M.J., Dal Peraro, M. | | Deposition date: | 2024-06-10 |
|
| PDBID: | 8rm2 | | Status: | HPUB -- hold until publication | | Title: | Erk2 MAP kinase T188E mutant | | Authors: | Livnah, O., Gutman, D. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 9fnb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-10 |
|
| PDBID: | 8ys3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of rat thioredoxin, F54L mutant | | Authors: | Takeshita, K., Baba, T., Ohe, C., Saji, S., Yamamoto, S., Yamamoto, M., Ouchida, M., Kawasaki-Ohmori, I. | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8rm8 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-05 | | Release date: | 2025-01-05 |
|
| PDBID: | 8ys2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9fnk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The structure of CBM42 from Clostridium thermocellum | | Authors: | Hadad, N., Lavid, N., Shoham, Y., Shoham, G. | | Deposition date: | 2024-06-10 | | Release date: | 2025-06-10 |
|
| PDBID: | 8rm4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 9fnj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-10 |
|
