| PDBID: | 9ioj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Escherichia coli Acetyl-coenzyme A Carboxylase Complex, Apo form (Double Ring) | | Authors: | Ng, J.C.H., Wen, X.K., Leung, S.K.P., Wang, J.Z.K., Lau, W.C.Y. | | Deposition date: | 2024-07-09 |
|
| PDBID: | 8rxd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-06 |
|
| PDBID: | 9bci | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 9gam | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-29 |
|
| PDBID: | 8rxe | | Status: | HPUB -- hold until publication | | Title: | NMR Solution Structure of Cold Shock Protein CspA | | Authors: | Wanko, M., Dambon, C., Feller, G., Volkov, O. | | Deposition date: | 2024-02-07 |
|
| PDBID: | 9bcf | | Status: | HPUB -- hold until publication | | Title: | Chimeric protein of crocodile allergen Cro p 1.0101 and GFP | | Authors: | O''Malley, A., Ruethers, T., Lopata, A.L., Chruszcz, M. | | Deposition date: | 2024-04-09 |
|
| PDBID: | 9gak | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-29 |
|
| PDBID: | 8rxi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-07 |
|
| PDBID: | 9bch | | Status: | HPUB -- hold until publication | | Title: | Solution structure of the hemoglobin receptor HbpA from Corynebacterium diphtheriae | | Authors: | Mahoney, B.J., Clubb, R.T. | | Deposition date: | 2024-04-09 | | Sequence: | >Entity 1
SEEVKNADLYWGFSGSSHHKYDHNGPKFEKAGKGAELTNIDAASAYAETFKKGVFPNNKREKSDILVFHNGEVKTETNHSSYQINWPGEVTMKLGYGDGLVIKDLNLMLKNGNMGELKATVGENSNITLFDVQEYSVSDNTITVTPKIPPCTTGTWKPWHNDLTSKLGSLKSVFFESYTCNNDDIAKKPLPLTVVLNG
|
|
| PDBID: | 9gau | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-29 |
|
| PDBID: | 8rxj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-07 |
|
| PDBID: | 9bcl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 9gaj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-29 |
|
| PDBID: | 8rxk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-07 |
|
| PDBID: | 9bck | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 9gai | | Status: | HPUB -- hold until publication | | Title: | 3-methylbenzoyl-CoA reductase from Thauera chlorobenzoica (MbdONPQ) | | Authors: | Ermler, U., Boll, M., Demmer, U., Fuchs, J. | | Deposition date: | 2024-07-29 |
|
| PDBID: | 8rxl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-07 | | Sequence: | >Entity 1
PAWQARGLGTARLQLVEFSAFVEPPDAVDSYQRHLFVHISQHCPSPGAPPLESVDVRQIYDKFPEKKGGLRELYDRGPPHAFFLVKFWADLNWGPSGEEAGAGGSISSGGFYGVSSQYESLEHMTLTCSSKVCSFGKQVVEKVETERAQLEDGRFVYRLLRSPMCEYLVNFLHKLRQLPERYMMNSVLENFTILQVVTNRDTQELLLCTAYVFEVSTSERGAQHHIYRLVRDVEHHHHHH
|
|
| PDBID: | 9bcn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 9gan | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-29 |
|
| PDBID: | 8rxs | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-07 |
|
| PDBID: | 9bco | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 9gap | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-29 |
|
| PDBID: | 8rxm | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Galectin-3 in complex with thiogalactoside derivative | | Authors: | Hakansson, M., Diehl, C., Peterson, K., Zetterberg, F., Nilsson, U. | | Deposition date: | 2024-02-07 |
|
| PDBID: | 9bcp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 9gaq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-29 |
|
