| PDBID: | 8rwd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-03 |
|
| PDBID: | 9isu | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Cytochrome P450BM3 V-19A14 Mutant Heme Domain with N-Decanoyl-L-Homoserine Lactone | | Authors: | Yokoyama, Y., Sugimoto, H., Shoji, O. | | Deposition date: | 2024-07-18 |
|
| PDBID: | 9bwk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-21 |
|
| PDBID: | 8rwe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-03 |
|
| PDBID: | 9iss | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Cytochrome P450BM3 III-10C1 Mutant Heme Domain with N-Decanoyl-L-Homoserine Lactone | | Authors: | Yokoyama, Y., Shoji, O., Sugimoto, H. | | Deposition date: | 2024-07-18 |
|
| PDBID: | 9bwm | | Status: | HPUB -- hold until publication | | Title: | Neutron Structure of Oxidized Tyr34Phe MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-05-21 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 8rwh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-04 |
|
| PDBID: | 9bwl | | Status: | PROC -- to be processed | | Title: | Crystal structure of polyketoacyl-CoA thiolase from Burkholderia sp in complex with butyryl-coA | | Authors: | Pereira, J.H., Wang, Z., Keasling, J.D., Adams, P.D. | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9isw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-18 |
|
| PDBID: | 8rwf | | Status: | HPUB -- hold until publication | | Title: | Domains 1 and 2 of Bacillus anthracis Sap S-layer in complex with Nb692 | | Authors: | Sogues, A., Remaut, H. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 9isq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Apo-state acetyltransferase | | Authors: | Park, J.B. | | Deposition date: | 2024-07-18 |
|
| PDBID: | 9bwo | | Status: | PROC -- to be processed | | Title: | Crystal structure of polyketoacyl-CoA thiolase from Burkholderia sp. in complex with acetyl-coA | | Authors: | Pereira, J.H., Wang, Z., Keasling, J.D., Adams, P.D. | | Deposition date: | 2024-05-21 |
|
| PDBID: | 8rwg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-04 |
|
| PDBID: | 9bwp | | Status: | PROC -- to be processed | | Title: | Crystal structure of polyketoacyl-CoA thiolase from Burkholderia sp. in complex with acetoacetyl-coA. | | Authors: | Pereira, J.H., Wang, Z., Keasling, J.D., Adams, P.D. | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9isl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-18 |
|
| PDBID: | 8rwn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 9isv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-18 |
|
| PDBID: | 9bwq | | Status: | HPUB -- hold until publication | | Title: | X-ray Counterpart to the Neutron Structure of Peroxide-Soaked Tyr34Phe MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-05-21 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 8rwx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 9bwr | | Status: | HPUB -- hold until publication | | Title: | X-ray Counterpart to the Neutron Structure of Reduced Tyr34Phe MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-05-21 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 9ism | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of MxaF/MxaJ complex | | Authors: | Sun, J.Q., Gao, F. | | Deposition date: | 2024-07-18 |
|
| PDBID: | 8rwi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 9isn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Streptomyces coelicolor sigma factor shbA transcription initiation complex | | Authors: | Liu, G., Zheng, J. | | Deposition date: | 2024-07-18 |
|
| PDBID: | 9bxe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-22 |
|
| PDBID: | 8rwp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
