| PDBID: | 9ikr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Tubulin-RB3-TTL-IKP105 | | Authors: | Yang, J.H. | | Deposition date: | 2024-06-28 | | Release date: | 2025-06-28 |
|
| PDBID: | 8raz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8yl2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-05 |
|
| PDBID: | 9iks | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Tubulin-DARPIN AC2 | | Authors: | Yang, J.H. | | Deposition date: | 2024-06-28 | | Release date: | 2025-06-28 |
|
| PDBID: | 8rb2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8ykr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-05 |
|
| PDBID: | 8rb0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8yl5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-05 |
|
| PDBID: | 9ikp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human malectin | | Authors: | Si, Y.L. | | Deposition date: | 2024-06-28 |
|
| PDBID: | 8rb1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8yl0 | | Status: | HOLD -- hold until a certain date | | Title: | cryo-EM structure of Staphylococcus aureus(ATCC 29213) 70S ribosome in complex with MCX-190. | | Authors: | Li, Y., Lu, G., Li, J., Pei, X., Lin, J. | | Deposition date: | 2024-03-05 | | Release date: | 2025-03-05 |
|
| PDBID: | 9iko | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | VF16QK in free solution | | Authors: | Swaleeha, A., Bhattacharyya, S. | | Deposition date: | 2024-06-28 |
|
| PDBID: | 8raq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8yl1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | cryo-EM structure of Staphylococcus aureus 70S ribosome (15B196) in complex with MCX-190. | | Authors: | Li, Y., Lu, G., Li, J., Pei, X., Lin, J. | | Deposition date: | 2024-03-05 |
|
| PDBID: | 9ikq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-28 |
|
| PDBID: | 8rar | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of chimeric human carbonic anhydrase IX with N-butyl-4-chloro-2-(cyclohexylsulfanyl)-5-sulfamoylbenzamide | | Authors: | Manakova, E.N., Smirnov, A., Paketuryte, V., Grazulis, S. | | Deposition date: | 2023-12-01 | | Sequence: | >Entity 1
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVEFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKALQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 8yl3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-05 |
|
| PDBID: | 9ikt | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the tetrapyrrole binding domain in CoaR at 2 angstrom resolution | | Authors: | Liu, X.C. | | Deposition date: | 2024-06-28 |
|
| PDBID: | 8rbj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8yks | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-05 |
|
| PDBID: | 9fwd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-29 |
|
| PDBID: | 8rbk | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8yku | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-05 |
|
| PDBID: | 9iku | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of CTB10 | | Authors: | Fu, K., Rao, Y.J. | | Deposition date: | 2024-06-29 |
|
| PDBID: | 9il8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of SME-1 Class A Carbapenemase in complex with Durlobactam | | Authors: | Dhankhar, K., Hazra, S. | | Deposition date: | 2024-06-29 |
|
