| PDBID: | 9fup | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-26 |
|
| PDBID: | 8r58 | | Status: | HPUB -- hold until publication | | Title: | The RSK 2 N-terminal kinase domain in complex with BMF (1-19) | | Authors: | Sok, P., Remenyi, A. | | Deposition date: | 2023-11-16 |
|
| PDBID: | 8yhx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the trimeric HerA | | Authors: | Zhen, X., Zhou, B., Xiong, X. | | Deposition date: | 2024-02-28 | | Release date: | 2025-02-28 |
|
| PDBID: | 9ful | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-26 |
|
| PDBID: | 8r5g | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-16 |
|
| PDBID: | 8yi2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-28 |
|
| PDBID: | 9fuo | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-26 |
|
| PDBID: | 8r5n | | Status: | HPUB -- hold until publication | | Title: | DTX1 WWE domain in complex with ATP | | Authors: | Muenzker, L., Zak, K.M., Boettcher, J. | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8yi1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-28 |
|
| PDBID: | 9fvb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-26 |
|
| PDBID: | 8r6a | | Status: | HPUB -- hold until publication | | Title: | DTX1 WWE domain in complex with ADP bound to WWE1 | | Authors: | Muenzker, L., Zak, K.M., Boettcher, J. | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8yic | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-02-29 | | Release date: | 2025-02-28 |
|
| PDBID: | 9fve | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-26 |
|
| PDBID: | 8r6b | | Status: | HPUB -- hold until publication | | Title: | DTX1 WWE domain in complex with ADP bound to WWE2 | | Authors: | Muenzker, L., Zak, K.M., Boettcher, J. | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8yig | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 9ik0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of PrfaH encoded by IncX3 plasmids | | Authors: | Yang, J., Lu, Y., Yu, J., Cai, X., Wang, C., Lv, L., Liu, J. | | Deposition date: | 2024-06-26 |
|
| PDBID: | 8r68 | | Status: | HPUB -- hold until publication | | Title: | Zorya anti-bacteriophage defense system ZorC WT | | Authors: | Hu, H., Taylor, N.M.I. | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8yid | | Status: | HPUB -- hold until publication | | Title: | Imine Reductase from Burkholderia ubonensis in complex with NADH and 6-methyl-2,3,4,5-tetrahydropyridine | | Authors: | Ma, Z.F., Shen, X.Y. | | Deposition date: | 2024-02-29 | | Sequence: | >Entity 1
MAQTVGVIGTGLMGSALVNTLLKAGTKVTVWDGRKEATAGVVANGAKLASSFVELVNGNDVVISIVSSASIGANLFREHVSQLNLDGRYVANLSTAMPEDGEAFRDIIESNGGRFISAAISSYPDLIGGPYTAIQYAGKEEVWRAVEATFKPLAPEGTIYTGANLAVPPIVDAAMTGSFYAVSLAGFLEAAAYAKARGVSPSQLGDFADKMLDLVRYKVHKSIREIEANNFETIQATVDVYLDAVIQWRDALKDVGLRASHIAALADDLTVTRDAGYGSLGFTAQFLTASKVD
|
|
| PDBID: | 9ika | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the tetrapyrrole binding domain in CoaR | | Authors: | Liu, X.C. | | Deposition date: | 2024-06-26 |
|
| PDBID: | 8r6i | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-22 |
|
| PDBID: | 8yik | | Status: | HPUB -- hold until publication | | Title: | pP1192R-ATPase-domain | | Authors: | Sun, J.Q., Liu, R.L. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 9ik1 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the human P2X3 receptor-compound 26a complex | | Authors: | Kim, S., Kim, G.R., Kim, Y.O., Han, X., Nagel, J., Kim, J., Song, D.I., Muller, C.E., Yoon, M.H., Jin, M.S., Kim, Y.C. | | Deposition date: | 2024-06-26 |
|
| PDBID: | 8r6j | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-22 |
|
| PDBID: | 8yi8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-29 |
|
| PDBID: | 9ik6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human Serum Albumin crystallized with T4, pH 6.5 | | Authors: | Xiang, W., Yue, Z.L., Su, J.Y. | | Deposition date: | 2024-06-26 |
|
