| PDBID: | 8y8j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-06 |
|
| PDBID: | 9fqu | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of MmCAT1 bound with FrMLV-RBD in the arginine-bound inward-occluded state | | Authors: | Ye, M., Zhou, D., Pike, A.C.W., Wang, S., Wang, D., Bakshi, S., Brooke, L., Williams, E., Elkins, J., Stuart, D.I., Sauer, D.B. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 8qpt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of pyrophosphatase from Ogataea parapolymorpha | | Authors: | Matyuta, I.O., Rodina, E.V., Vorobyeva, N.N., Kurilova, S.A., Bezpalaya, E.Y., Boyko, K.M. | | Deposition date: | 2023-10-03 | | Sequence: | >Entity 1
MLKLSRALSSVVSGTRNSPSFKTYLRLKDGKIGSFFHDVPLGLDKQKRIANMVVEIPRWVNAKYEISKDFKANPIVQDTKKGKLRYLNNIYPNHGVPHNYGAFPQTWESPLESSSLVNQNILGDNDPLDVIDIGRFVSSTGTVKPVKILGSLALVDDGELDWKVVVIDTNDPFAAELNDIKDVYEKMPGVLENLKRWFEVYKIPTGKEPNSFLFDGNYKDTEFTLKVVQECHENWYKLVMGELHGDNLPSTENATLPHTKGNTVFDVEIEVSQKAEQVPPEVNDMSFIK
|
|
| PDBID: | 8y8i | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-06 |
|
| PDBID: | 9fqv | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of MmCAT1 bound with FrMLV-RBD in the lysine-bound inward-occluded state | | Authors: | Ye, M., Zhou, D., Pike, A.C.W., Wang, S., Wang, D., Bakshi, S., Brooke, L., Williams, E., Elkins, J., Stuart, D.I., Sauer, D.B. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 8qpu | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-03 |
|
| PDBID: | 8y8g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-06 |
|
| PDBID: | 9fqw | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of MmCAT1 bound with FrMLV-RBD in the ornithine-bound inward-occluded state | | Authors: | Ye, M., Zhou, D., Pike, A.C.W., Wang, S., Wang, D., Bakshi, S., Brooke, L., Williams, E., Elkins, J., Stuart, D.I., Sauer, D.B. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 8qql | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the human inward-rectifier potassium 2.1 channel (Kir2.1) - R312H mutant | | Authors: | Fernandes, C.A.H., Zuniga, D., Venien-Bryan, C. | | Deposition date: | 2023-10-05 |
|
| PDBID: | 8y9f | | Status: | HOLD -- hold until a certain date | | Title: | ATAT-2 bound MEC-12/MEC-7 microtubule | | Authors: | Lam, W.H., Yu, D., Zhai, Y., Ti, S. | | Deposition date: | 2024-02-06 | | Release date: | 2025-02-06 |
|
| PDBID: | 9feu | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-21 |
|
| PDBID: | 8qqq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-06 |
|
| PDBID: | 8y8k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-06 |
|
| PDBID: | 9ff8 | | Status: | HPUB -- hold until publication | | Title: | Human transthyretin (TTR) in complex with (E)-2-((((2-chlorobenzyl)oxy)imino)methyl)benzoic acid (Lic166) | | Authors: | Ciccone, L., Shepard, W., Sirigu, S., Camodeca, C., Mazzoccchi, F., Fruchart, C., Nencetti, S., Orlandini, E. | | Deposition date: | 2024-05-22 |
|
| PDBID: | 8qr2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand | | Authors: | Gelin, M., Labesse, G. | | Deposition date: | 2023-10-06 |
|
| PDBID: | 8y86 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-06 |
|
| PDBID: | 9ff9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-22 |
|
| PDBID: | 8qr3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand | | Authors: | Gelin, M., Labesse, G. | | Deposition date: | 2023-10-06 |
|
| PDBID: | 8y9e | | Status: | HPUB -- hold until publication | | Title: | Versatile Aromatic Prenyltransferase auraA for Imidazole-Containing Diketopiperazines | | Authors: | Dehai, L., Yuzhong, Z., Wenxue, W., Peng, W. | | Deposition date: | 2024-02-06 |
|
| PDBID: | 9fhh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-27 |
|
| PDBID: | 8qr4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand | | Authors: | Gelin, M., Labesse, G. | | Deposition date: | 2023-10-06 |
|
| PDBID: | 8y9d | | Status: | HPUB -- hold until publication | | Title: | Versatile Aromatic Prenyltransferase auraA in complex with DMAPP and cyclo-(L-Val-L-His) | | Authors: | Dehai, L., Yuzhong, Z., Wenxue, W., Peng, W. | | Deposition date: | 2024-02-06 |
|
| PDBID: | 9fgc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-23 |
|
| PDBID: | 8qr5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand | | Authors: | Gelin, M., Labesse, G. | | Deposition date: | 2023-10-06 |
|
| PDBID: | 8y9j | | Status: | HPUB -- hold until publication | | Title: | Structure of the Ebola virus nucleocapsid subunit | | Authors: | Fujita-Fujiharu, Y., Hu, S., Hirabayashi, A., Takamatsu, Y., Ng, Y., Houri, K., Muramoto, Y., Nakano, M., Sugita, Y., Noda, T. | | Deposition date: | 2024-02-06 |
|
