| PDBID: | 8qqj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-04 |
|
| PDBID: | 8y3j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-29 |
|
| PDBID: | 9fct | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-05-15 | | Release date: | 2025-05-15 |
|
| PDBID: | 8qqh | | Status: | HPUB -- hold until publication | | Title: | Structure of beta-galactosidase from Desulfurococcus amyloliticus | | Authors: | Samygina, V.R., Kil, Y., Sergeev, R.S., Rychkov, G.N. | | Deposition date: | 2023-10-04 |
|
| PDBID: | 8y3k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-29 |
|
| PDBID: | 9fnf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-10 |
|
| PDBID: | 8qum | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 8y3l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-29 |
|
| PDBID: | 9fni | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-10 |
|
| PDBID: | 8quo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8y3z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-29 |
|
| PDBID: | 9fnc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-10 |
|
| PDBID: | 8quf | | Status: | HPUB -- hold until publication | | Title: | carbonic anhydrase XII mimic in complex with 2-(3-((N-(4-sulfamoylbenzyl)pyridine-3-sulfonamido)methyl)phenoxy)acetic acid | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-10-16 | | Sequence: | >Entity 1
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFKVNFDDSQDKAVLKGGPLDGTYRLTQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDASKASQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLNETVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 8y6k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 2or6 | | Status: | POLC -- waiting for a policy decision | | Title: | EPR STRUCTURE OF THE NA+/H+ ANTIPORTER NHAA DIMER | | Authors: | Hilger, D., Polyhach, Y., Padan, E., Jung, H., Jeschke, G. | | Deposition date: | 2007-02-02 |
|
| PDBID: | 9fng | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-10 |
|
| PDBID: | 8qup | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8yet | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-23 |
|
| PDBID: | 9fnh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-10 |
|
| PDBID: | 8pwc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MDM2 with Brigimadlin | | Authors: | Bader, G., Wolkerstorfer, B. | | Deposition date: | 2023-07-20 | | Release date: | 2025-01-20 |
|
| PDBID: | 8y79 | | Status: | HPUB -- hold until publication | | Title: | extracellular domain of a synaptic adhesion receptor in complex with a long peptide | | Authors: | Liu, H., Meng, J. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 9fno | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-10 |
|
| PDBID: | 8pwf | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-07-20 |
|
| PDBID: | 8y7s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 9etv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
