| PDBID: | 9csu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Streptavidin-E101Q-S112Y-K121A bound to Cu(II)-biotin-ethyl-dipicolylamine cofactor | | Authors: | Uyeda, K.S., Follmer, A.H., Borovik, A.S. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 8xrm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-07 |
|
| PDBID: | 9csv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Streptavidin-E101Q-S112Y-K121A bound to Cu(II)-biotin-ethyl-dipicolylamine cofactor, oxidized by hydrogen peroxide | | Authors: | Uyeda, K.S., Follmer, A.H., Borovik, A.S. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 8xrj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-07 |
|
| PDBID: | 9csw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Streptavidin-E101Q-S112A-K121Y bound to Cu(II)-biotin-ethyl-dipicolylamine cofactor | | Authors: | Uyeda, K.S., Follmer, A.H., Borovik, A.S. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 8jfw | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of RDGC/apo-CaM complex | | Authors: | Liu, Z.M., Liu, W., Wu, C., Liu, J. | | Deposition date: | 2023-05-19 | | Release date: | 2024-11-19 |
|
| PDBID: | 9ct6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 8xrk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-07 |
|
| PDBID: | 8jfy | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of RDGC/Ca2+-CaM complex | | Authors: | Liu, Z.M., Liu, W., Wu, C., Liu, J. | | Deposition date: | 2023-05-19 | | Release date: | 2024-11-19 |
|
| PDBID: | 9ctb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-24 |
|
| PDBID: | 8xro | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structure of 5-Aminoimidazole Ribonucleotide (AIR) Synthetase from Pyrococcus horikoshii with ATP | | Authors: | Chen, Y.H., Chen, C.J. | | Deposition date: | 2024-01-07 | | Release date: | 2025-01-07 |
|
| PDBID: | 9ct2 | | Status: | PROC -- to be processed | | Title: | Cryo-EM structure of SARS-CoV-2 spike protein Ecto-domain with internal tag, All RBD down conformation, State-3 | | Authors: | Singh, S., Hasan, S.S. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 8xs2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 | | Sequence: | >Entity 1
MATGQVKLQQSGAEFVKAGASVKLSCKTSGYTFNNYWIHWVKQSPGQGLEWIGEIDPSDGYSNYNQKFKGKATLTVDKSSSTAYMHLNSLTSEDSAVYYCTSSTSVGGSWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSASAAHHHHHHGAAEQKLISEEDLNGAA
>Entity 2
MSDIELTQSPLSLPVSLGDQASISCTSSQSLLHSNGDTYLHWYLQKPGQSPKLLIYTLSNRFSGVPDRFSGSGSGTDFTLKISRVEAADLGIYFCSQTTHVPYTFGGGTKLEIKRADAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEGGGSDYKDDDDK
|
|
| PDBID: | 9ctd | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-24 |
|
| PDBID: | 8xs1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 9cku | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-09 |
|
| PDBID: | 8xrs | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8jgl | | Status: | AUCO -- author corrections pending review | | Title: | Cryo-EM structure of mClC-3 with AMP | | Authors: | Wan, Y.Z.Q., Yang, F. | | Deposition date: | 2023-05-21 | | Release date: | 2024-08-28 |
|
| PDBID: | 9ctj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-25 |
|
| PDBID: | 8jgv | | Status: | AUCO -- author corrections pending review | | Title: | Cryo-EM structure of mClC-3_I607T with ATP | | Authors: | Wan, Y.Z.Q., Yang, F. | | Deposition date: | 2023-05-21 | | Release date: | 2024-08-28 |
|
| PDBID: | 8xrw | | Status: | HOLD -- hold until a certain date | | Title: | crystal structure of HpPPAT in complex with ATP | | Authors: | Yin, H.S. | | Deposition date: | 2024-01-08 | | Release date: | 2025-01-08 |
|
| PDBID: | 9ctp | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9ctn | | Status: | PROC -- to be processed | | Title: | Modifying region of EcPKS2 - acetylated dataset | | Authors: | Schubert, H.L., Hill, C.P., Li, F., Schmidt, E.W. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 8xsq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9cu3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-25 |
|
